cysH Resolved · high auto-curated

H37Rv Rv2392 · MTBC0 mtbc0_002545 · 254 aa · 2710560–2711324 (+) · RefSeq NP_216908.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)phosphoadenosine phosphosulfate reductase
MTBC0 PGAP re-annotationphosphoadenylyl-sulfate reductase
Revised (this work)Phosphoadenylyl-sulfate reductase. Pfam: PAPS_reduct (PF01507.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIK3 SwissProt · reviewed · Evidence at protein level
UniProt nameAdenosine 5'-phosphosulfate reductase
EC (curated) EC 1.8.4.10
Curated functionCatalyzes the formation of sulfite from adenosine 5'-phosphosulfate (APS) using thioredoxin as an electron donor.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
H Coenzyme transport and metabolism
Preferred namecysH
eggNOG descriptionBelongs to the PAPS reductase family. CysH subfamily
Orthologous groupCOG0175
EC number EC 1.8.4.10, EC 1.8.4.8
KEGG orthology K00390
KEGG pathways map00920, map01100, map01120
KEGG modules M00176
Gene Ontology (58) GO:0000096, GO:0000097, GO:0003674, GO:0003824, GO:0004604, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886 +46 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.342 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PAPS_reductPF01507.26 1.0e-5260–228 Phosphoadenosine phosphosulfate reductase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cysC (adenylyl-sulfate kinase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1286 cysC adenylyl-sulfate kinase 999 1000 ctx cooccurence:653 coexpression:984 experimental:999 database:900 textmining:637
Rv2391 sirA sulfite reductase 999 1000 ctx neighborhood:882 fusion:497 cooccurence:767 coexpression:971 database:900 textmining:845
Rv2393 che1 ferrochelatase 990 989 ctx neighborhood:881 coexpression:891
Rv2394 ggtB gamma-glutamyltranspeptidase precursor GgtB 957 935 ctx neighborhood:653 coexpression:819
Rv2131c cysQ 3'(2'),5'-bisphosphate nucleotidase CysQ 968 911 database:900 textmining:659
Rv0815c cysA2 thiosulfate sulfurtransferase CysA 926 906 database:900
Rv3283 sseA thiosulfate sulfurtransferase SseA 909 904 database:900
Rv2291 sseB thiosulfate sulfurtransferase SseB 909 904 database:900
Rv2837c nrnA bifunctional oligoribonuclease/PAP phosphatase NrnA 903 903 database:900
Rv2847c cysG multifunctional uroporphyrin-III C-methyltransferase/precorrin-2 oxidase/ferrochelatase 932 899 ctx cooccurence:408 coexpression:808
Rv3106 fprA NADPH-ferredoxin reductase FprA 836 812 coexpression:766
Rv3340 metC O-acetylhomoserine sulfhydrylase 887 781 coexpression:769 textmining:508
Rv1285 cysD sulfate adenylyltransferase subunit 2 934 749 ctx cooccurence:688 textmining:748
Rv2399c cysT sulfate ABC transporter permease CysT 759 730 coexpression:677
Rv2064 cobG precorrin-3B synthase 744 720 coexpression:663

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: phosphoadenosine phosphosulfate reductase
  • MTBC0 PGAP product: phosphoadenylyl-sulfate reductase
  • Pfam (hmmscan --cut_ga): PAPS_reduct PF01507.26 (E=1e-52)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216908.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PAPS_reduct (PF01507.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0175
  • Curated reference: UniProt P9WIK3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 44 functional partner(s); context anchor cysC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002545|Rv2392|cysH
MSGETTRLTEPQLRELAARGAAELDGATATDMLRWTDETFGDIGGAGGGVSGHRGWTTCNYVVASNMADAVLVDLAAKVRPGVPVIFLDTGYHFVETIGTRDAIESVYDVRVLNVTPEHTVAEQDELLGKDLFARNPHECCRLRKVVPLGKTLRGYSAWVTGLRRVDAPTRANAPLVSFDETFKLVKVNPLAAWTDQDVQEYIADNDVLVNPLVREGYPSIGCAPCTAKPAEGADPRSGRWQGLAKTECGLHAS