Rv1510 Family assigned · low

H37Rv Rv1510 · MTBC0 mtbc0_001616 · 432 aa · 1711104–1712402 (+) · RefSeq NP_216026.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)MATE multidrug-transporter fold (PDB 6FHZ); putative membrane transporter.

Curated reference (UniProt)

UniProt P9WLW1 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv1510

UniProt still lists this protein as Uncharacterized protein Rv1510; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionpolysaccharide biosynthetic process
Orthologous groupCOG2244
Gene Ontology (7) GO:0003674, GO:0005488, GO:0008150, GO:0009987, GO:0044764, GO:0046812, GO:0051704

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.398 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.27% of strains (399) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 94.5 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
6fhz-assembly1_A 1.00 0.70 5.4e-07 sig 6fhz-assembly1_A Inward-facing conformation of a multidrug resistance MATE family transporter of the MOP superfamily.
4mlb-assembly1_C 1.00 0.62 5.0e-07 sig 4mlb-assembly1_C Reverse polarity of binding pocket suggests different function of a MOP superfamily transporter from Pyrococcus furiosus Vc1 (DSM3638)
6hfb-assembly3_C 1.00 0.63 1.0e-06 sig 6hfb-assembly3_C Outward-facing conformation of a multidrug resistance MATE family transporter of the MOP superfamily.
3vvs-assembly1_A 1.00 0.65 4.5e-06 sig 3vvs-assembly1_A Crystal structure of MATE in complex with MaD3S
3vvo-assembly1_A 1.00 0.63 4.7e-06 sig 3vvo-assembly1_A Crystal structure of MATE in the bent conformation
6gwh-assembly1_A 1.00 0.60 6.8e-06 sig 6gwh-assembly1_A Outward-facing conformation of a multidrug resistance MATE family transporter of the MOP superfamily.
3vvr-assembly1_A 1.00 0.61 1.4e-05 sig 3vvr-assembly1_A Crystal structure of MATE in complex with MaD5
3w4t-assembly1_A 1.00 0.63 2.5e-05 sig 3w4t-assembly1_A Crystal structure of MATE P26A mutant

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3632 (membrane protein), high confidence from genomic context alone (score 723 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0334 rmlA glucose-1-phosphate thymidylyltransferase 901 886 coexpression:858
Rv3465 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase 901 873 coexpression:856
Rv0322 udgA UDP-glucose 6-dehydrogenase UdgA 895 868 coexpression:857
Rv3809c glf UDP-galactopyranose mutase 882 868 coexpression:857
Rv3464 rmlB dTDP-glucose 4,6-dehydratase 809 784 coexpression:731
Rv3784 dTDP-glucose 4,6-dehydratase 789 760 coexpression:731
Rv3632 membrane protein 726 723 ctx cooccurence:656
Rv3779 transmembrane protein 704 705 ctx cooccurence:686
Rv0290 eccD3 ESX-3 secretion system protein EccD 702 703 ctx cooccurence:701
Rv3810 pirG cell surface protein 619 620 ctx cooccurence:605
Rv3631 transferase 627 607 ctx cooccurence:463
Rv3707c hyp hypothetical protein 591 591 ctx cooccurence:589
Rv0273c transcriptional regulator 585 585 ctx cooccurence:579
Rv0557 mgtA GDP-mannose-dependent alpha-mannosyltransferase 575 548 coexpression:420
Rv0518 hyp hypothetical protein 571 547 ctx cooccurence:525

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 6fhz-assembly1_A Inward-facing conformation of a multidrug resistance MATE famil (prob 1.00, E=5e-07, TM=0.70)
  • (structure-only promotion reviewed by hand, 2026-06-01)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216026.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2244
  • Curated reference: UniProt P9WLW1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 94.5, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 76 functional partner(s); context anchor Rv3632
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001616|Rv1510|
MYERRHERGMCDRAVEMTDVGATAAPTGPIARGSVARVGAATALAVACVYTVIYLAARDLPPACFSIFAVFWGALGIATGATHGLLQETTREVRWVRSTQIVAGHRTHPLRVAGMIGTVAAVVIAGSSPLWSRQLFVEGRWLSVGLLSVGVAGFCAQATLLGALAGVDRWTQYGSLMVTDAVIRLAVAAAAVVIGWGLAGYLWAATAGAVAWLLMLMASPTARSAASLLTPGGIATFVRGAAHSITAAGASAILVMGFPVLLKVTSDQLGAKGGAVILAVTLTRAPLLVPLSAMQGNLIAHFVDRRTQRLRALIAPALVVGGIGAVGMLAAGLTGPWLLRVGFGPDYQTGGALLAWLTAAAVAIAMLTLTGAAAVAAALHRAYLLGWVSATVASTLLLLLPMPLETRTVIALLFGPTVGIAIHVAALARRPD