Rv1510 Family assigned · low
H37Rv Rv1510 · MTBC0 mtbc0_001616 ·
432 aa · 1711104–1712402 (+) ·
RefSeq NP_216026.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | MATE multidrug-transporter fold (PDB 6FHZ); putative membrane transporter. |
Curated reference (UniProt)
| UniProt |
P9WLW1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv1510 |
UniProt still lists this protein as Uncharacterized protein Rv1510; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | polysaccharide biosynthetic process |
| Orthologous group | COG2244 |
| Gene Ontology (7) |
GO:0003674, GO:0005488, GO:0008150, GO:0009987, GO:0044764, GO:0046812, GO:0051704
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.398 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 3 missense, 0 nonsense, 2 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 0.27% of strains (399) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 94.5 (very high). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
6fhz-assembly1_A |
1.00 | 0.70 | 5.4e-07 sig | 6fhz-assembly1_A Inward-facing conformation of a multidrug resistance MATE family transporter of the MOP superfamily. |
4mlb-assembly1_C |
1.00 | 0.62 | 5.0e-07 sig | 4mlb-assembly1_C Reverse polarity of binding pocket suggests different function of a MOP superfamily transporter from Pyrococcus furiosus Vc1 (DSM3638) |
6hfb-assembly3_C |
1.00 | 0.63 | 1.0e-06 sig | 6hfb-assembly3_C Outward-facing conformation of a multidrug resistance MATE family transporter of the MOP superfamily. |
3vvs-assembly1_A |
1.00 | 0.65 | 4.5e-06 sig | 3vvs-assembly1_A Crystal structure of MATE in complex with MaD3S |
3vvo-assembly1_A |
1.00 | 0.63 | 4.7e-06 sig | 3vvo-assembly1_A Crystal structure of MATE in the bent conformation |
6gwh-assembly1_A |
1.00 | 0.60 | 6.8e-06 sig | 6gwh-assembly1_A Outward-facing conformation of a multidrug resistance MATE family transporter of the MOP superfamily. |
3vvr-assembly1_A |
1.00 | 0.61 | 1.4e-05 sig | 3vvr-assembly1_A Crystal structure of MATE in complex with MaD5 |
3w4t-assembly1_A |
1.00 | 0.63 | 2.5e-05 sig | 3w4t-assembly1_A Crystal structure of MATE P26A mutant |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv3632 (membrane protein), high confidence from genomic context alone (score 723 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0334 rmlA |
glucose-1-phosphate thymidylyltransferase | 901 | 886 | coexpression:858 |
Rv3465 rmlC |
dTDP-4-dehydrorhamnose 3,5-epimerase | 901 | 873 | coexpression:856 |
Rv0322 udgA |
UDP-glucose 6-dehydrogenase UdgA | 895 | 868 | coexpression:857 |
Rv3809c glf |
UDP-galactopyranose mutase | 882 | 868 | coexpression:857 |
Rv3464 rmlB |
dTDP-glucose 4,6-dehydratase | 809 | 784 | coexpression:731 |
Rv3784 |
dTDP-glucose 4,6-dehydratase | 789 | 760 | coexpression:731 |
Rv3632 |
membrane protein | 726 | 723 ctx | cooccurence:656 |
Rv3779 |
transmembrane protein | 704 | 705 ctx | cooccurence:686 |
Rv0290 eccD3 |
ESX-3 secretion system protein EccD | 702 | 703 ctx | cooccurence:701 |
Rv3810 pirG |
cell surface protein | 619 | 620 ctx | cooccurence:605 |
Rv3631 |
transferase | 627 | 607 ctx | cooccurence:463 |
Rv3707c hyp |
hypothetical protein | 591 | 591 ctx | cooccurence:589 |
Rv0273c |
transcriptional regulator | 585 | 585 ctx | cooccurence:579 |
Rv0557 mgtA |
GDP-mannose-dependent alpha-mannosyltransferase | 575 | 548 | coexpression:420 |
Rv0518 hyp |
hypothetical protein | 571 | 547 ctx | cooccurence:525 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- MTBC0 PGAP product: hypothetical protein
- Foldseek best: 6fhz-assembly1_A Inward-facing conformation of a multidrug resistance MATE famil (prob 1.00, E=5e-07, TM=0.70)
- (structure-only promotion reviewed by hand, 2026-06-01)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216026.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2244 - Curated reference: UniProt P9WLW1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 94.5, very high)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
76 functional partner(s); context anchor
Rv3632 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001616|Rv1510| MYERRHERGMCDRAVEMTDVGATAAPTGPIARGSVARVGAATALAVACVYTVIYLAARDLPPACFSIFAVFWGALGIATGATHGLLQETTREVRWVRSTQIVAGHRTHPLRVAGMIGTVAAVVIAGSSPLWSRQLFVEGRWLSVGLLSVGVAGFCAQATLLGALAGVDRWTQYGSLMVTDAVIRLAVAAAAVVIGWGLAGYLWAATAGAVAWLLMLMASPTARSAASLLTPGGIATFVRGAAHSITAAGASAILVMGFPVLLKVTSDQLGAKGGAVILAVTLTRAPLLVPLSAMQGNLIAHFVDRRTQRLRALIAPALVVGGIGAVGMLAAGLTGPWLLRVGFGPDYQTGGALLAWLTAAAVAIAMLTLTGAAAVAAALHRAYLLGWVSATVASTLLLLLPMPLETRTVIALLFGPTVGIAIHVAALARRPD