Rv1516c Resolved · high auto-curated
H37Rv Rv1516c · MTBC0 mtbc0_001623 ·
336 aa · 1717338–1718348 (-) ·
RefSeq NP_216032.2
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | sugar transferase |
|---|---|
| MTBC0 PGAP re-annotation | glycosyltransferase |
| Revised (this work) | Glycosyltransferase. Pfam: Glyco_tranf_2_3 (PF13641.13), Glycos_transf_2 (PF00535.33). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P71795
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable sugar transferase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
M Cell wall / membrane / envelope biogenesis
|
|---|---|
| eggNOG description | Glycosyltransferase like family 2 |
| Orthologous group | COG0463 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.639 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Glyco_tranf_2_3 | PF13641.13 | 3.1e-06 | 7–122 | Glycosyltransferase like family 2 |
Glycos_transf_2 | PF00535.33 | 4.6e-30 | 10–170 | Glycosyl transferase family 2 |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1514c (glycosyltransferase), high confidence from genomic context alone (score 782 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1515c hyp |
hypothetical protein | 976 | 976 ctx | neighborhood:882 coexpression:806 |
Rv1518 hyp |
hypothetical protein | 832 | 832 ctx | cooccurence:745 |
Rv1514c |
glycosyltransferase | 782 | 782 ctx | neighborhood:712 |
Rv2957 |
PGL/p-HBAD biosynthesis glycosyltransferase | 766 | 766 ctx | cooccurence:752 |
Rv2121c hisG |
ATP phosphoribosyltransferase | 706 | 706 | coexpression:703 |
Rv3781 rfbE |
O-antigen/lipopolysaccharide ABC transporter ATP-binding protein RfbE | 445 | 416 | |
Rv1519 hyp |
hypothetical protein | 430 | 408 | |
Rv0334 rmlA |
glucose-1-phosphate thymidylyltransferase | 429 | 399 | |
Rv3464 rmlB |
dTDP-glucose 4,6-dehydratase | 418 | 392 | |
Rv3465 rmlC |
dTDP-4-dehydrorhamnose 3,5-epimerase | 400 | 368 | |
Rv1510 hyp |
hypothetical protein | 841 | 175 | textmining:816 |
Rv1506c hyp |
hypothetical protein | 872 | 58 | textmining:870 |
Rv1508c |
membrane protein | 807 | 55 | textmining:805 |
Rv3876 espI |
ESX-1 secretion-associated protein EspI | 441 | 41 | textmining:441 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: sugar transferase
- MTBC0 PGAP product: glycosyltransferase
- Pfam (hmmscan --cut_ga): Glyco_tranf_2_3 PF13641.13 (E=3e-06), Glycos_transf_2 PF00535.33 (E=5e-30)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216032.2)
- Domains: Pfam-A via hmmscan --cut_ga — Glyco_tranf_2_3 (PF13641.13), Glycos_transf_2 (PF00535.33)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0463 - Curated reference: UniProt P71795 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
14 functional partner(s); context anchor
Rv1514c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001623|Rv1516c| MSPQLCPKVSIVSTTHNQAGYARQAFDSFLDQQTDFPVEIIVADDASTDATPAIIREYAERYPHVFRPIFRTENLGLNGNLTGALSAARGEYVALCEADDYWIDPLKLSKQVAFLDRHPKTTVCFHPVRVIWEDGHAKDSKFPPVRVRGNLSLDALILMNFIQTNSAVYRRLERYDDIPADVMPLDWYLHVRHAVHGDIAMLPDTMAVYRRHAQGMWHNQVVDPPKFWLTQGPGHAATFDAMLDLFPGDPAREELIAVMADWILRQIANVPGPEGRAALQETIARHPRIAMLALQHRGATPARRLKTQWRKLAAATPSRRGLVDVWPSRLRRGCRA