Rv1516c Resolved · high auto-curated

H37Rv Rv1516c · MTBC0 mtbc0_001623 · 336 aa · 1717338–1718348 (-) · RefSeq NP_216032.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)sugar transferase
MTBC0 PGAP re-annotationglycosyltransferase
Revised (this work)Glycosyltransferase. Pfam: Glyco_tranf_2_3 (PF13641.13), Glycos_transf_2 (PF00535.33).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71795 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable sugar transferase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
eggNOG descriptionGlycosyltransferase like family 2
Orthologous groupCOG0463

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.639 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Glyco_tranf_2_3PF13641.13 3.1e-067–122 Glycosyltransferase like family 2
Glycos_transf_2PF00535.33 4.6e-3010–170 Glycosyl transferase family 2

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1514c (glycosyltransferase), high confidence from genomic context alone (score 782 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1515c hyp hypothetical protein 976 976 ctx neighborhood:882 coexpression:806
Rv1518 hyp hypothetical protein 832 832 ctx cooccurence:745
Rv1514c glycosyltransferase 782 782 ctx neighborhood:712
Rv2957 PGL/p-HBAD biosynthesis glycosyltransferase 766 766 ctx cooccurence:752
Rv2121c hisG ATP phosphoribosyltransferase 706 706 coexpression:703
Rv3781 rfbE O-antigen/lipopolysaccharide ABC transporter ATP-binding protein RfbE 445 416
Rv1519 hyp hypothetical protein 430 408
Rv0334 rmlA glucose-1-phosphate thymidylyltransferase 429 399
Rv3464 rmlB dTDP-glucose 4,6-dehydratase 418 392
Rv3465 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase 400 368
Rv1510 hyp hypothetical protein 841 175 textmining:816
Rv1506c hyp hypothetical protein 872 58 textmining:870
Rv1508c membrane protein 807 55 textmining:805
Rv3876 espI ESX-1 secretion-associated protein EspI 441 41 textmining:441

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: sugar transferase
  • MTBC0 PGAP product: glycosyltransferase
  • Pfam (hmmscan --cut_ga): Glyco_tranf_2_3 PF13641.13 (E=3e-06), Glycos_transf_2 PF00535.33 (E=5e-30)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216032.2)
  • Domains: Pfam-A via hmmscan --cut_ga — Glyco_tranf_2_3 (PF13641.13), Glycos_transf_2 (PF00535.33)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0463
  • Curated reference: UniProt P71795 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor Rv1514c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001623|Rv1516c|
MSPQLCPKVSIVSTTHNQAGYARQAFDSFLDQQTDFPVEIIVADDASTDATPAIIREYAERYPHVFRPIFRTENLGLNGNLTGALSAARGEYVALCEADDYWIDPLKLSKQVAFLDRHPKTTVCFHPVRVIWEDGHAKDSKFPPVRVRGNLSLDALILMNFIQTNSAVYRRLERYDDIPADVMPLDWYLHVRHAVHGDIAMLPDTMAVYRRHAQGMWHNQVVDPPKFWLTQGPGHAATFDAMLDLFPGDPAREELIAVMADWILRQIANVPGPEGRAALQETIARHPRIAMLALQHRGATPARRLKTQWRKLAAATPSRRGLVDVWPSRLRRGCRA