udgA Family assigned · medium auto-curated
H37Rv Rv0322 · MTBC0 mtbc0_000343 ·
443 aa ·
392583–393914 MTBC0
(+) ·
RefSeq NP_214836.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | UDP-glucose 6-dehydrogenase UdgA |
|---|---|
| MTBC0 PGAP re-annotation | UDP-glucose/GDP-mannose dehydrogenase family protein |
| Revised (this work) | UDP-glucose/GDP-mannose dehydrogenase family protein. Pfam: UDPG_MGDP_dh_N (PF03721.21), UDPG_MGDP_dh (PF00984.25), UDPG_MGDP_dh_C (PF03720.23). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) never studied
No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) antiparallel · 1 % of gene
| Neighbour | Rv0323c (Rv0323c, - strand) |
|---|---|
| Overlap | 12 bp, 1 % of this gene's length |
antiparallel overlap: this gene may inherit essentiality/conservation signal from its neighbour through shared TA sites or promoter constraint, without any protein of its own being produced (cf. Rv2438A/nadE) Signals attributed to this gene (Tn-seq essentiality via shared TA sites, conservation via promoter constraint) should be cross-checked against the neighbour before being read as its own. P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Unc_7.
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.90 (95% CI -2.84 to 6.14). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Possibly involved in polysaccharide biosynthesis [catalytic activity: UDP-glucose + 2 NAD+ + H2O = UDP-glucuronate + 2 NADH]. |
|---|---|
| Mycobrowser EC |
1.1.1.22
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0330
· 99.8% identity |
|---|---|
| M. marinum |
MMAR_0603
· 89.7% identity |
| M. smegmatis |
MSMEG_0680
· 85.0% identity |
| M. orygis |
RJtmp_000339
· 99.5% identity |
| M. abscessus |
MAB_4295c
· 79.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O07248
TrEMBL · unreviewed
· Inferred from homology
|
|---|---|
| UniProt name | UDP-glucose 6-dehydrogenase |
| EC (curated) |
EC 1.1.1.22
|
| Curated function | Catalyzes the conversion of UDP-glucose into UDP-glucuronate, one of the precursors of teichuronic acid. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
M Cell wall / membrane / envelope biogenesis
|
|---|---|
| Preferred name | ugd |
| eggNOG description | Belongs to the UDP-glucose GDP-mannose dehydrogenase family |
| Orthologous group | COG1004 |
| EC number |
EC 1.1.1.22
|
| KEGG orthology |
K00012
|
| KEGG pathways |
map00040, map00053, map00520, map01100
|
| KEGG modules |
M00014, M00129, M00361, M00362
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.719 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 3 missense, 1 nonsense, 0 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.26% of strains (372) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 50/53 (94%) · mean identity 88.7%
· 4/4 closest MTBAP relatives conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 60.2% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 24 in the ORF — 0 in the essential state, 0 growth-defect, 24 non-essential, 0 growth-advantage. Saturation 0.958, mean read count 66.5217391304. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 3 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 0.16 ppm · rank 3446/3519 (2.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 443 aa |
|---|---|
| Molecular weight | 47.4 kDa |
| Theoretical pI | 5.85 |
| GRAVY | 0.122 (hydrophobic) |
| Aliphatic index | 101.6 |
| Aromaticity | 0.065 |
| Instability index | 30.4 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
UDPG_MGDP_dh_N | PF03721.21 | 6.3e-62 | 1–181 | UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain |
UDPG_MGDP_dh | PF00984.25 | 4.6e-31 | 204–297 | UDP-glucose/GDP-mannose dehydrogenase family, central domain |
UDPG_MGDP_dh_C | PF03720.23 | 2.3e-29 | 322–422 | UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.5
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2y0e-assembly2_A |
1.00 | 0.95 | 1.1e-43 sig | 2y0e-assembly2_A BceC and the final step of UGDs reaction |
2y0c-assembly1_A |
1.00 | 0.95 | 2.9e-43 sig | 2y0c-assembly1_A BceC mutation Y10S |
2y0d-assembly1_C |
1.00 | 0.94 | 5.3e-43 sig | 2y0d-assembly1_C BceC mutation Y10K |
2y0e-assembly1_C |
1.00 | 0.94 | 5.0e-43 sig | 2y0e-assembly1_C BceC and the final step of UGDs reaction |
4a7p-assembly2_B-2 |
1.00 | 0.97 | 2.3e-42 sig | 4a7p-assembly2_B-2 Se-Met derivatized UgdG, UDP-glucose dehydrogenase from Sphingomonas elodea |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | dcd (+ strand, 105 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0323c (- strand, -12 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: rmlA (glucose-1-phosphate thymidylyltransferase), high confidence from genomic context alone (score 932 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3634c galE1 exp |
UDP-glucose 4-epimerase | 969 | 967 | coexpression:412 database:900 |
Rv0993 galU exp |
UTP--glucose-1-phosphate uridylyltransferase | 973 | 963 | coexpression:463 database:900 |
Rv3468c exp |
dTDP-glucose 4,6-dehydratase | 960 | 958 | coexpression:415 database:900 |
Rv0501 galE2 exp |
UDP-glucose 4-epimerase GalE | 950 | 948 | coexpression:414 database:900 |
Rv0334 rmlA |
glucose-1-phosphate thymidylyltransferase | 958 | 932 ctx | neighborhood:544 coexpression:857 textmining:417 |
Rv3809c glf |
UDP-galactopyranose mutase | 876 | 869 | coexpression:858 |
Rv3465 rmlC |
dTDP-4-dehydrorhamnose 3,5-epimerase | 899 | 868 | coexpression:857 |
Rv1510 hyp |
hypothetical protein | 895 | 868 | coexpression:857 |
Rv0618 galTa exp |
Rv0618, (MTCY19H5.03c), len: 231 aa (probable partial CDS). Probable galTa, first part of galactose-1-phosphate uridylyltransferase, highly | 829 | 823 | database:800 |
Rv3784 |
dTDP-glucose 4,6-dehydratase | 838 | 788 | coexpression:704 |
Rv3630 |
integral membrane protein | 804 | 778 | coexpression:733 |
Rv3464 rmlB |
dTDP-glucose 4,6-dehydratase | 822 | 735 | coexpression:704 |
Rv0321 dcd |
deoxycytidine triphosphate deaminase | 612 | 611 ctx | neighborhood:611 |
Rv0112 gca |
GDP-mannose 4,6-dehydratase | 617 | 596 | coexpression:412 |
Rv0557 mgtA |
GDP-mannose-dependent alpha-mannosyltransferase | 824 | 583 | coexpression:442 textmining:596 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: UDP-glucose 6-dehydrogenase UdgA
- MTBC0 PGAP product: UDP-glucose/GDP-mannose dehydrogenase family protein
- Pfam (hmmscan --cut_ga): UDPG_MGDP_dh_N PF03721.21 (E=6e-62), UDPG_MGDP_dh PF00984.25 (E=5e-31), UDPG_MGDP_dh_C PF03720.23 (E=2e-29)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214836.1)
- Domains: Pfam-A via hmmscan --cut_ga — UDPG_MGDP_dh_N (PF03721.21), UDPG_MGDP_dh (PF00984.25), UDPG_MGDP_dh_C (PF03720.23)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1004 - Curated reference: UniProt O07248 (TrEMBL, unreviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.5)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
56 functional partner(s); context anchor
rmlA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000343|Rv0322|udgA MRCSVFGTGYLGATHAVGMAQLGHEVVGVDIDPGKVAKLAGGDIPFYEPGLRKLLTDNLAAGRLRFTTDYDMAADFADVHFLGVGTPQKIGEYGADLRHVHAVIDALVPRLVRASILVGKSTVPVGTAAELGHRAGALAPRGVDVEIAWNPEFLREGFAVHDTLNPDRIVLGVQDDSTRAEVAVRELYAPLLAAGVPFLVTDLQTAELVKVSANAFLATKISFINAISEVCEAAGADVSQLADALGYDPRIGRQCLNAGLGFGGGCLPKDIRAFMARAGELGADQALTFLREVDSINMRRRTKMVELATTACGGSLLGANIAVLGAAFKPESDDVRDSPALNVAGQLQLNGATVHVYDPKALDNAHRLFPTLNYAVSVAEACERADAVLVLTEWREFIDLEPADLANRVRARVIVDGRNCLDVTRWRRAGWRVFRLGVPRLGH
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for udgA? Email the maintainer — the message is pre-filled with this gene's details.