udgA Family assigned · medium auto-curated

H37Rv Rv0322 · MTBC0 mtbc0_000343 · 443 aa · 392583–393914 (+) · RefSeq NP_214836.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)UDP-glucose 6-dehydrogenase UdgA
MTBC0 PGAP re-annotationUDP-glucose/GDP-mannose dehydrogenase family protein
Revised (this work)UDP-glucose/GDP-mannose dehydrogenase family protein. Pfam: UDPG_MGDP_dh_N (PF03721.21), UDPG_MGDP_dh (PF00984.25), UDPG_MGDP_dh_C (PF03720.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07248 TrEMBL · unreviewed · Inferred from homology
UniProt nameUDP-glucose 6-dehydrogenase
EC (curated) EC 1.1.1.22
Curated functionCatalyzes the conversion of UDP-glucose into UDP-glucuronate, one of the precursors of teichuronic acid.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred nameugd
eggNOG descriptionBelongs to the UDP-glucose GDP-mannose dehydrogenase family
Orthologous groupCOG1004
EC number EC 1.1.1.22
KEGG orthology K00012
KEGG pathways map00040, map00053, map00520, map01100
KEGG modules M00014, M00129, M00361, M00362

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.719 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.26% of strains (372) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
UDPG_MGDP_dh_NPF03721.21 6.3e-621–181 UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain
UDPG_MGDP_dhPF00984.25 4.6e-31204–297 UDP-glucose/GDP-mannose dehydrogenase family, central domain
UDPG_MGDP_dh_CPF03720.23 2.3e-29322–422 UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rmlA (glucose-1-phosphate thymidylyltransferase), high confidence from genomic context alone (score 932 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3634c galE1 UDP-glucose 4-epimerase 969 967 coexpression:412 database:900
Rv0993 galU UTP--glucose-1-phosphate uridylyltransferase 973 963 coexpression:463 database:900
Rv3468c dTDP-glucose 4,6-dehydratase 960 958 coexpression:415 database:900
Rv0501 galE2 UDP-glucose 4-epimerase GalE 950 948 coexpression:414 database:900
Rv0334 rmlA glucose-1-phosphate thymidylyltransferase 958 932 ctx neighborhood:544 coexpression:857 textmining:417
Rv3809c glf UDP-galactopyranose mutase 876 869 coexpression:858
Rv3465 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase 899 868 coexpression:857
Rv1510 hyp hypothetical protein 895 868 coexpression:857
Rv0618 galTa Rv0618, (MTCY19H5.03c), len: 231 aa (probable partial CDS). Probable galTa, first part of galactose-1-phosphate uridylyltransferase, highly 829 823 database:800
Rv3784 dTDP-glucose 4,6-dehydratase 838 788 coexpression:704
Rv3630 integral membrane protein 804 778 coexpression:733
Rv3464 rmlB dTDP-glucose 4,6-dehydratase 822 735 coexpression:704
Rv0321 dcd deoxycytidine triphosphate deaminase 612 611 ctx neighborhood:611
Rv0112 gca GDP-mannose 4,6-dehydratase 617 596 coexpression:412
Rv0557 mgtA GDP-mannose-dependent alpha-mannosyltransferase 824 583 coexpression:442 textmining:596

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: UDP-glucose 6-dehydrogenase UdgA
  • MTBC0 PGAP product: UDP-glucose/GDP-mannose dehydrogenase family protein
  • Pfam (hmmscan --cut_ga): UDPG_MGDP_dh_N PF03721.21 (E=6e-62), UDPG_MGDP_dh PF00984.25 (E=5e-31), UDPG_MGDP_dh_C PF03720.23 (E=2e-29)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214836.1)
  • Domains: Pfam-A via hmmscan --cut_ga — UDPG_MGDP_dh_N (PF03721.21), UDPG_MGDP_dh (PF00984.25), UDPG_MGDP_dh_C (PF03720.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1004
  • Curated reference: UniProt O07248 (TrEMBL, unreviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 56 functional partner(s); context anchor rmlA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000343|Rv0322|udgA
MRCSVFGTGYLGATHAVGMAQLGHEVVGVDIDPGKVAKLAGGDIPFYEPGLRKLLTDNLAAGRLRFTTDYDMAADFADVHFLGVGTPQKIGEYGADLRHVHAVIDALVPRLVRASILVGKSTVPVGTAAELGHRAGALAPRGVDVEIAWNPEFLREGFAVHDTLNPDRIVLGVQDDSTRAEVAVRELYAPLLAAGVPFLVTDLQTAELVKVSANAFLATKISFINAISEVCEAAGADVSQLADALGYDPRIGRQCLNAGLGFGGGCLPKDIRAFMARAGELGADQALTFLREVDSINMRRRTKMVELATTACGGSLLGANIAVLGAAFKPESDDVRDSPALNVAGQLQLNGATVHVYDPKALDNAHRLFPTLNYAVSVAEACERADAVLVLTEWREFIDLEPADLANRVRARVIVDGRNCLDVTRWRRAGWRVFRLGVPRLGH