udgA Family assigned · medium auto-curated

H37Rv Rv0322 · MTBC0 mtbc0_000343 · 443 aa · 392583–393914 MTBC0 (+) · RefSeq NP_214836.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv0309 (Rv0309) — requalified: L%2CD-transpeptidase Rv0310c (Rv0310c) — family_assigned: nuclear transport factor 2 family protein Rv0311 (Rv0311) — family_assigned: hypothetical protein Rv0311 Rv0312 (Rv0312) — family_assigned: Hsp70 family protein Rv0312 Rv0313 (Rv0313) — family_assigned: hypothetical protein Rv0315 (Rv0315) — requalified: family 16 glycosylhydrolase Rv0315 Rv0316 (Rv0316) — family_assigned: muconolactone Delta-isomerase family protein glpQ2 (Rv0317c) — requalified: glycerophosphodiester phosphodiesterase pcp (Rv0319) — requalified: pyroglutamyl-peptidase I Rv0320 (Rv0320) — family_assigned: hypothetical protein dcd (Rv0321) — requalified: dCTP deaminase udgA (Rv0322) — family_assigned: UDP-glucose/GDP-mannose dehydrogenase family protein udgA Rv0323c (Rv0323c) — family_assigned: PIG-L deacetylase family protein Rv0324 (Rv0324) — family_assigned: metalloregulator ArsR/SmtB family transcription factor cyp135A1 (Rv0327c) — requalified: cytochrome P450 cyp135A1 Rv0328 (Rv0328) — family_assigned: TetR/AcrR family transcriptional regulator Rv0329c (Rv0329c) — requalified: class I SAM-dependent methyltransferase Rv0330c (Rv0330c) — family_assigned: helix-turn-helix domain-containing protein Rv0331 (Rv0331) — requalified: FAD/NAD(P)-binding oxidoreductase Rv0331 Rv0333 (Rv0333) — family_assigned: nuclear transport factor 2 family protein rmlA (Rv0334) — requalified: glucose-1-phosphate thymidylyltransferase RfbA rmlA aspC (Rv0337c) — requalified: pyridoxal phosphate-dependent aminotransferase 384 kb 388 kb 392 kb 396 kb 400 kb 404 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)UDP-glucose 6-dehydrogenase UdgA
MTBC0 PGAP re-annotationUDP-glucose/GDP-mannose dehydrogenase family protein
Revised (this work)UDP-glucose/GDP-mannose dehydrogenase family protein. Pfam: UDPG_MGDP_dh_N (PF03721.21), UDPG_MGDP_dh (PF00984.25), UDPG_MGDP_dh_C (PF03720.23).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) antiparallel · 1 % of gene

NeighbourRv0323c (Rv0323c, - strand)
Overlap12 bp, 1 % of this gene's length

antiparallel overlap: this gene may inherit essentiality/conservation signal from its neighbour through shared TA sites or promoter constraint, without any protein of its own being produced (cf. Rv2438A/nadE) Signals attributed to this gene (Tn-seq essentiality via shared TA sites, conservation via promoter constraint) should be cross-checked against the neighbour before being read as its own. P20.1, derived from GFF3 gene coordinates, 2026-08-03.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): Unc_7.

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index 0.90 (95% CI -2.84 to 6.14). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionPossibly involved in polysaccharide biosynthesis [catalytic activity: UDP-glucose + 2 NAD+ + H2O = UDP-glucuronate + 2 NADH].
Mycobrowser EC 1.1.1.22 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0330 · 99.8% identity
M. marinum MMAR_0603 · 89.7% identity
M. smegmatis MSMEG_0680 · 85.0% identity
M. orygis RJtmp_000339 · 99.5% identity
M. abscessus MAB_4295c · 79.8% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O07248 TrEMBL · unreviewed · Inferred from homology
UniProt nameUDP-glucose 6-dehydrogenase
EC (curated) EC 1.1.1.22
Curated functionCatalyzes the conversion of UDP-glucose into UDP-glucuronate, one of the precursors of teichuronic acid.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred nameugd
eggNOG descriptionBelongs to the UDP-glucose GDP-mannose dehydrogenase family
Orthologous groupCOG1004
EC number EC 1.1.1.22
KEGG orthology K00012
KEGG pathways map00040, map00053, map00520, map01100
KEGG modules M00014, M00129, M00361, M00362

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.719 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.26% of strains (372) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) inf (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 50/53 (94%) · mean identity 88.7% · 4/4 closest MTBAP relatives
conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 60.2%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 24 in the ORF — 0 in the essential state, 0 growth-defect, 24 non-essential, 0 growth-advantage. Saturation 0.958, mean read count 66.5217391304. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 3 of 16 independent MS datasets
Integrated abundance0.16 ppm · rank 3446/3519 (2.1th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length443 aa
Molecular weight47.4 kDa
Theoretical pI5.85
GRAVY0.122 (hydrophobic)
Aliphatic index101.6
Aromaticity0.065
Instability index30.4 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
UDPG_MGDP_dh_NPF03721.21 6.3e-621–181 UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain
UDPG_MGDP_dhPF00984.25 4.6e-31204–297 UDP-glucose/GDP-mannose dehydrogenase family, central domain
UDPG_MGDP_dh_CPF03720.23 2.3e-29322–422 UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.5

PDB hitprobTM-scoreE-valueDescription
2y0e-assembly2_A 1.00 0.95 1.1e-43 sig 2y0e-assembly2_A BceC and the final step of UGDs reaction
2y0c-assembly1_A 1.00 0.95 2.9e-43 sig 2y0c-assembly1_A BceC mutation Y10S
2y0d-assembly1_C 1.00 0.94 5.3e-43 sig 2y0d-assembly1_C BceC mutation Y10K
2y0e-assembly1_C 1.00 0.94 5.0e-43 sig 2y0e-assembly1_C BceC and the final step of UGDs reaction
4a7p-assembly2_B-2 1.00 0.97 2.3e-42 sig 4a7p-assembly2_B-2 Se-Met derivatized UgdG, UDP-glucose dehydrogenase from Sphingomonas elodea

Foldseek search of the AlphaFold DB model (mean pLDDT 96.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)dcd (+ strand, 105 bp gap)
Downstream (3' on genome)Rv0323c (- strand, -12 bp gap)

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: rmlA (glucose-1-phosphate thymidylyltransferase), high confidence from genomic context alone (score 932 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3634c galE1 exp UDP-glucose 4-epimerase 969 967 coexpression:412 database:900
Rv0993 galU exp UTP--glucose-1-phosphate uridylyltransferase 973 963 coexpression:463 database:900
Rv3468c exp dTDP-glucose 4,6-dehydratase 960 958 coexpression:415 database:900
Rv0501 galE2 exp UDP-glucose 4-epimerase GalE 950 948 coexpression:414 database:900
Rv0334 rmlA glucose-1-phosphate thymidylyltransferase 958 932 ctx neighborhood:544 coexpression:857 textmining:417
Rv3809c glf UDP-galactopyranose mutase 876 869 coexpression:858
Rv3465 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase 899 868 coexpression:857
Rv1510 hyp hypothetical protein 895 868 coexpression:857
Rv0618 galTa exp Rv0618, (MTCY19H5.03c), len: 231 aa (probable partial CDS). Probable galTa, first part of galactose-1-phosphate uridylyltransferase, highly 829 823 database:800
Rv3784 dTDP-glucose 4,6-dehydratase 838 788 coexpression:704
Rv3630 integral membrane protein 804 778 coexpression:733
Rv3464 rmlB dTDP-glucose 4,6-dehydratase 822 735 coexpression:704
Rv0321 dcd deoxycytidine triphosphate deaminase 612 611 ctx neighborhood:611
Rv0112 gca GDP-mannose 4,6-dehydratase 617 596 coexpression:412
Rv0557 mgtA GDP-mannose-dependent alpha-mannosyltransferase 824 583 coexpression:442 textmining:596

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: UDP-glucose 6-dehydrogenase UdgA
  • MTBC0 PGAP product: UDP-glucose/GDP-mannose dehydrogenase family protein
  • Pfam (hmmscan --cut_ga): UDPG_MGDP_dh_N PF03721.21 (E=6e-62), UDPG_MGDP_dh PF00984.25 (E=5e-31), UDPG_MGDP_dh_C PF03720.23 (E=2e-29)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214836.1)
  • Domains: Pfam-A via hmmscan --cut_ga — UDPG_MGDP_dh_N (PF03721.21), UDPG_MGDP_dh (PF00984.25), UDPG_MGDP_dh_C (PF03720.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1004
  • Curated reference: UniProt O07248 (TrEMBL, unreviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.5)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 56 functional partner(s); context anchor rmlA
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000343|Rv0322|udgA
MRCSVFGTGYLGATHAVGMAQLGHEVVGVDIDPGKVAKLAGGDIPFYEPGLRKLLTDNLAAGRLRFTTDYDMAADFADVHFLGVGTPQKIGEYGADLRHVHAVIDALVPRLVRASILVGKSTVPVGTAAELGHRAGALAPRGVDVEIAWNPEFLREGFAVHDTLNPDRIVLGVQDDSTRAEVAVRELYAPLLAAGVPFLVTDLQTAELVKVSANAFLATKISFINAISEVCEAAGADVSQLADALGYDPRIGRQCLNAGLGFGGGCLPKDIRAFMARAGELGADQALTFLREVDSINMRRRTKMVELATTACGGSLLGANIAVLGAAFKPESDDVRDSPALNVAGQLQLNGATVHVYDPKALDNAHRLFPTLNYAVSVAEACERADAVLVLTEWREFIDLEPADLANRVRARVIVDGRNCLDVTRWRRAGWRVFRLGVPRLGH