Rv1514c Family assigned · medium auto-curated
H37Rv Rv1514c · MTBC0 mtbc0_001621 ·
262 aa · 1715616–1716404 (-) ·
RefSeq NP_216030.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | glycosyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | glycosyltransferase family 2 protein |
| Revised (this work) | Glycosyltransferase family 2 protein. Pfam: Glycos_transf_2 (PF00535.33). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WMX9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized glycosyltransferase Rv1514c |
| EC (curated) |
EC 2.4.-.-
|
UniProt still lists this protein as Uncharacterized glycosyltransferase Rv1514c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Glycosyl transferase family 2 |
| Orthologous group | COG1216 |
| Gene Ontology (4) |
GO:0003674, GO:0003824, GO:0016740, GO:0016757
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.22 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Glycos_transf_2 | PF00535.33 | 4.1e-15 | 8–111 | Glycosyl transferase family 2 |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1516c (sugar transferase), high confidence from genomic context alone (score 782 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1515c hyp |
hypothetical protein | 787 | 787 ctx | neighborhood:712 |
Rv1516c |
sugar transferase | 782 | 782 ctx | neighborhood:712 |
Rv1512 epiA |
nucleotide-sugar epimerase EpiA | 784 | 778 ctx | cooccurence:735 |
Rv1508A hyp |
hypothetical protein | 731 | 722 ctx | cooccurence:679 |
Rv1511 gmdA |
GDP-D-mannose dehydratase GmdA | 682 | 671 ctx | cooccurence:622 |
Rv1518 hyp |
hypothetical protein | 533 | 533 | |
Rv1520 |
sugar transferase | 475 | 475 | |
Rv1519 hyp |
hypothetical protein | 411 | 389 | |
Rv1513 hyp |
hypothetical protein | 912 | 353 | textmining:870 |
Rv0113 gmhA |
phosphoheptose isomerase | 542 | 186 | textmining:461 |
Rv1650 pheT |
phenylalanine--tRNA ligase subunit beta | 469 | 68 | textmining:454 |
Rv3775 lipE |
lipase LipE | 444 | 47 | textmining:441 |
Rv2964 purU |
formyltetrahydrofolate deformylase | 517 | 42 | textmining:517 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: glycosyltransferase
- MTBC0 PGAP product: glycosyltransferase family 2 protein
- Pfam (hmmscan --cut_ga): Glycos_transf_2 PF00535.33 (E=4e-15)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216030.1)
- Domains: Pfam-A via hmmscan --cut_ga — Glycos_transf_2 (PF00535.33)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1216 - Curated reference: UniProt P9WMX9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
13 functional partner(s); context anchor
Rv1516c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001621|Rv1514c| MTSAPTVSVITISFNDLDGLQRTVKSVRAQRYRGRIEHIVIDGGSGDDVVAYLSGCEPGFAYWQSEPDGGRYDAMNQGIAHASGDLLWFLHSADRFSGPDVVAQAVEALSGKGPVSELWGFGMDRLVGLDRVRGPIPFSLRKFLAGKQVVPHQASFFGSSLVAKIGGYDLDFGIAADQEFILRAALVCEPVTIRCVLCEFDTTGVGSHREPSAVFGDLRRMGDLHRRYPFGGRRISHAYLRGREFYAYNSRFWENVFTRMSK