Rv1514c Family assigned · medium auto-curated

H37Rv Rv1514c · MTBC0 mtbc0_001621 · 262 aa · 1715616–1716404 (-) · RefSeq NP_216030.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)glycosyltransferase
MTBC0 PGAP re-annotationglycosyltransferase family 2 protein
Revised (this work)Glycosyltransferase family 2 protein. Pfam: Glycos_transf_2 (PF00535.33).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WMX9 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized glycosyltransferase Rv1514c
EC (curated) EC 2.4.-.-

UniProt still lists this protein as Uncharacterized glycosyltransferase Rv1514c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionGlycosyl transferase family 2
Orthologous groupCOG1216
Gene Ontology (4) GO:0003674, GO:0003824, GO:0016740, GO:0016757

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.22 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Glycos_transf_2PF00535.33 4.1e-158–111 Glycosyl transferase family 2

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1516c (sugar transferase), high confidence from genomic context alone (score 782 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1515c hyp hypothetical protein 787 787 ctx neighborhood:712
Rv1516c sugar transferase 782 782 ctx neighborhood:712
Rv1512 epiA nucleotide-sugar epimerase EpiA 784 778 ctx cooccurence:735
Rv1508A hyp hypothetical protein 731 722 ctx cooccurence:679
Rv1511 gmdA GDP-D-mannose dehydratase GmdA 682 671 ctx cooccurence:622
Rv1518 hyp hypothetical protein 533 533
Rv1520 sugar transferase 475 475
Rv1519 hyp hypothetical protein 411 389
Rv1513 hyp hypothetical protein 912 353 textmining:870
Rv0113 gmhA phosphoheptose isomerase 542 186 textmining:461
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 469 68 textmining:454
Rv3775 lipE lipase LipE 444 47 textmining:441
Rv2964 purU formyltetrahydrofolate deformylase 517 42 textmining:517

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: glycosyltransferase
  • MTBC0 PGAP product: glycosyltransferase family 2 protein
  • Pfam (hmmscan --cut_ga): Glycos_transf_2 PF00535.33 (E=4e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216030.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Glycos_transf_2 (PF00535.33)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1216
  • Curated reference: UniProt P9WMX9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor Rv1516c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001621|Rv1514c|
MTSAPTVSVITISFNDLDGLQRTVKSVRAQRYRGRIEHIVIDGGSGDDVVAYLSGCEPGFAYWQSEPDGGRYDAMNQGIAHASGDLLWFLHSADRFSGPDVVAQAVEALSGKGPVSELWGFGMDRLVGLDRVRGPIPFSLRKFLAGKQVVPHQASFFGSSLVAKIGGYDLDFGIAADQEFILRAALVCEPVTIRCVLCEFDTTGVGSHREPSAVFGDLRRMGDLHRRYPFGGRRISHAYLRGREFYAYNSRFWENVFTRMSK