Rv1502 Family assigned · low
H37Rv Rv1502 · MTBC0 mtbc0_001607 ·
299 aa · 1702729–1703628 (+) ·
RefSeq NP_216018.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Glycoside-hydrolase fold (PDB 5MUI); putative glycosidase. |
Curated reference (UniProt)
| UniProt |
P9WLW7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv1502 |
UniProt still lists this protein as Uncharacterized protein Rv1502; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
G Carbohydrate transport and metabolism
|
|---|---|
| eggNOG description | beta-fructofuranosidase activity |
| Orthologous group | COG1621 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.4 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 8 missense, 0 nonsense, 2 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 5.96% of strains (8651) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 95.2 (very high). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
5mui-assembly1_A |
1.00 | 0.77 | 7.7e-12 sig | 5mui-assembly1_A Glycoside hydrolase BT_0996 |
7vco-assembly1_A |
1.00 | 0.67 | 2.6e-09 sig | 7vco-assembly1_A Frischella perrara beta-fructofuranosidase |
3r67-assembly2_B |
1.00 | 0.74 | 1.5e-08 sig | 3r67-assembly2_B Crystal structure of a putative glycosidase (BT_4094) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.30 A resolution |
3qc2-assembly2_B |
1.00 | 0.69 | 6.3e-09 sig | 3qc2-assembly2_B Crystal structure of a glycosyl hydrolase (BACOVA_03624) from Bacteroides ovatus at 2.30 A resolution |
7bwc-assembly1_A |
1.00 | 0.64 | 3.2e-09 sig | 7bwc-assembly1_A Bombyx mori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose |
3qc2-assembly1_A |
1.00 | 0.68 | 7.6e-09 sig | 3qc2-assembly1_A Crystal structure of a glycosyl hydrolase (BACOVA_03624) from Bacteroides ovatus at 2.30 A resolution |
3taw-assembly1_A |
1.00 | 0.65 | 2.4e-09 sig | 3taw-assembly1_A Crystal structure of a putative glycoside hydrolase (BDI_3141) from Parabacteroides distasonis ATCC 8503 at 1.70 A resolution |
5ta7-assembly2_B |
1.00 | 0.67 | 1.7e-08 sig | 5ta7-assembly2_B Crystal structure of BuGH117Bwt |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: pimF (glycosyltransferase), medium confidence from genomic context alone (score 694 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1505c hyp |
hypothetical protein | 815 | 798 ctx | cooccurence:773 |
Rv1501 hyp |
hypothetical protein | 766 | 767 ctx | neighborhood:505 cooccurence:469 |
Rv1507c hyp |
hypothetical protein | 762 | 761 ctx | cooccurence:688 |
Rv1500 pimF |
glycosyltransferase | 709 | 694 ctx | neighborhood:466 cooccurence:431 |
Rv1506c hyp |
hypothetical protein | 609 | 609 ctx | cooccurence:578 |
Rv3781 rfbE |
O-antigen/lipopolysaccharide ABC transporter ATP-binding protein RfbE | 475 | 456 | coexpression:425 |
Rv1504c |
Rv1504c, (MTCY277.26c), len: 199 aa. Conserved hypothetical protein, similar to N-terminal region of P27833|RFFA_ECOLI lipopolysaccharide bi | 463 | 417 | |
Rv3242c hyp |
hypothetical protein | 434 | 413 | coexpression:413 |
Rv1503c |
Rv1503c, (MTCY277.25c), len: 182 aa. Conserved hypothetical protein, similar to C-terminal region of P27833|RFFA_ECOLI lipopolysaccharide bi | 423 | 373 | |
Rv2006 otsB1 |
trehalose-6-phosphate phosphatase OtsB | 485 | 277 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- MTBC0 PGAP product: hypothetical protein
- Foldseek best: 5mui-assembly1_A Glycoside hydrolase BT_0996 (prob 1.00, E=8e-12, TM=0.77)
- (structure-only promotion reviewed by hand, 2026-06-01)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216018.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1621 - Curated reference: UniProt P9WLW7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 95.2, very high)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
10 functional partner(s); context anchor
pimF - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001607|Rv1502| MAWRKLGRIFAPSGELDWSRSHAALPVPEWIEGDIFRIYFSGRDGQNRSSIGSVIVDLAVGGKILDIPAEPILRPGARGMFDDCGVSIGSIVRAGDTRLLYYTGWNLAVTVPWKNTIGVAISEAGAPFERWSTFPVVALDERDPFSLSYPWVIQDGGTYRMWYGSNLGWGEGTDEIPHVIRYAQSRDGVHWEKQDRVHIDTSGSDNSAACRPCVVRDAGVYRMWFCARGAKYRIYCATSEDGLTWRQLGKDEGIDVSPDSWDSDMIEYPCVFDHRGQRFMLYSGDGYGRTGFGLAVLEN