Rv1502 Family assigned · low

H37Rv Rv1502 · MTBC0 mtbc0_001607 · 299 aa · 1702729–1703628 (+) · RefSeq NP_216018.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Glycoside-hydrolase fold (PDB 5MUI); putative glycosidase.

Curated reference (UniProt)

UniProt P9WLW7 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv1502

UniProt still lists this protein as Uncharacterized protein Rv1502; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category G Carbohydrate transport and metabolism
eggNOG descriptionbeta-fructofuranosidase activity
Orthologous groupCOG1621

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.4 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 8 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 5.96% of strains (8651) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 95.2 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
5mui-assembly1_A 1.00 0.77 7.7e-12 sig 5mui-assembly1_A Glycoside hydrolase BT_0996
7vco-assembly1_A 1.00 0.67 2.6e-09 sig 7vco-assembly1_A Frischella perrara beta-fructofuranosidase
3r67-assembly2_B 1.00 0.74 1.5e-08 sig 3r67-assembly2_B Crystal structure of a putative glycosidase (BT_4094) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.30 A resolution
3qc2-assembly2_B 1.00 0.69 6.3e-09 sig 3qc2-assembly2_B Crystal structure of a glycosyl hydrolase (BACOVA_03624) from Bacteroides ovatus at 2.30 A resolution
7bwc-assembly1_A 1.00 0.64 3.2e-09 sig 7bwc-assembly1_A Bombyx mori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose
3qc2-assembly1_A 1.00 0.68 7.6e-09 sig 3qc2-assembly1_A Crystal structure of a glycosyl hydrolase (BACOVA_03624) from Bacteroides ovatus at 2.30 A resolution
3taw-assembly1_A 1.00 0.65 2.4e-09 sig 3taw-assembly1_A Crystal structure of a putative glycoside hydrolase (BDI_3141) from Parabacteroides distasonis ATCC 8503 at 1.70 A resolution
5ta7-assembly2_B 1.00 0.67 1.7e-08 sig 5ta7-assembly2_B Crystal structure of BuGH117Bwt

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pimF (glycosyltransferase), medium confidence from genomic context alone (score 694 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1505c hyp hypothetical protein 815 798 ctx cooccurence:773
Rv1501 hyp hypothetical protein 766 767 ctx neighborhood:505 cooccurence:469
Rv1507c hyp hypothetical protein 762 761 ctx cooccurence:688
Rv1500 pimF glycosyltransferase 709 694 ctx neighborhood:466 cooccurence:431
Rv1506c hyp hypothetical protein 609 609 ctx cooccurence:578
Rv3781 rfbE O-antigen/lipopolysaccharide ABC transporter ATP-binding protein RfbE 475 456 coexpression:425
Rv1504c Rv1504c, (MTCY277.26c), len: 199 aa. Conserved hypothetical protein, similar to N-terminal region of P27833|RFFA_ECOLI lipopolysaccharide bi 463 417
Rv3242c hyp hypothetical protein 434 413 coexpression:413
Rv1503c Rv1503c, (MTCY277.25c), len: 182 aa. Conserved hypothetical protein, similar to C-terminal region of P27833|RFFA_ECOLI lipopolysaccharide bi 423 373
Rv2006 otsB1 trehalose-6-phosphate phosphatase OtsB 485 277

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 5mui-assembly1_A Glycoside hydrolase BT_0996 (prob 1.00, E=8e-12, TM=0.77)
  • (structure-only promotion reviewed by hand, 2026-06-01)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216018.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1621
  • Curated reference: UniProt P9WLW7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 95.2, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 10 functional partner(s); context anchor pimF
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001607|Rv1502|
MAWRKLGRIFAPSGELDWSRSHAALPVPEWIEGDIFRIYFSGRDGQNRSSIGSVIVDLAVGGKILDIPAEPILRPGARGMFDDCGVSIGSIVRAGDTRLLYYTGWNLAVTVPWKNTIGVAISEAGAPFERWSTFPVVALDERDPFSLSYPWVIQDGGTYRMWYGSNLGWGEGTDEIPHVIRYAQSRDGVHWEKQDRVHIDTSGSDNSAACRPCVVRDAGVYRMWFCARGAKYRIYCATSEDGLTWRQLGKDEGIDVSPDSWDSDMIEYPCVFDHRGQRFMLYSGDGYGRTGFGLAVLEN