rmlC Resolved · high auto-curated
H37Rv Rv3465 · MTBC0 mtbc0_003683 ·
202 aa ·
3908774–3909382 MTBC0
(+) ·
RefSeq NP_217982.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | dTDP-4-dehydrorhamnose 3,5-epimerase |
|---|---|
| MTBC0 PGAP re-annotation | dTDP-4-dehydrorhamnose 3%2C5-epimerase |
| Revised (this work) | DTDP-4-dehydrorhamnose 3%2C5-epimerase. Pfam: dTDP_sugar_isom (PF00908.24). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 13 publications
13 TB publications mention this gene. 13 publication(s) discuss this gene (13 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Rhamnose-Containing Compounds: Biosynthesis and Applications. doi:10.3390/molecules27165315 | 2022 |
| Streptococcal dTDP-L-rhamnose biosynthesis enzymes: functional characterization and lead compound identification. doi:10.1111/mmi.14197 | 2019 |
| A structural and functional perspective on the enzymes of Mycobacterium tuberculosis involved in the L-rhamnose biosynthesis pathway. doi:10.1016/j.pbiomolbio.2018.12.004 | 2019 |
| Computational evaluation of phytocompounds for combating drug resistant tuberculosis by multi-targeted therapy. doi:10.1007/s00894-015-2785-z | 2015 |
| Virtual screening for the identification of novel inhibitors of Mycobacterium tuberculosis cell wall synthesis: inhibitors targeting RmlB and RmlC. doi:10.1016/j.compbiomed.2014.12.020 | 2015 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -0.99 (95% CI -1.18 to -0.81). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in dTDP-L-rhamnose biosynthesis, within the O antigen biosynthesis pathway of lipopolysaccharide biosynthesis: conversion of dTDP-4-keto-6-deoxy-D-glucose to dTDP-4-keto-rhamnose [catalytic activity: dTDP-4-dehydro-6-deoxy-D-glucose = dTDP-4-dehydro-6-deoxy-L-mannose]. |
|---|---|
| Mycobrowser EC |
5.1.3.13
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3494
· 100.0% identity |
|---|---|
| M. leprae |
ML1965
· 75.4% identity |
| M. marinum |
MMAR_1081
· 82.7% identity |
| M. smegmatis |
MSMEG_1510
· 66.5% identity |
| M. orygis |
RJtmp_003573
· 100.0% identity |
| M. abscessus |
MAB_3780
· 58.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WH11
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | dTDP-4-dehydrorhamnose 3,5-epimerase |
| EC (curated) |
EC 5.1.3.13
|
| Curated function | Catalyzes the epimerization of the C3' and C5'positions of dTDP-6-deoxy-D-xylo-4-hexulose, forming dTDP-6-deoxy-L-lyxo-4-hexulose. Involved in the biosynthesis of the dTDP-L-rhamnose which is a component of the critical linker, D-N-acetylglucosamine-L-rhamnose disaccharide, which connects the galactan region of arabinogalactan to peptidoglycan via a phosphodiester linkage. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
M Cell wall / membrane / envelope biogenesis
|
|---|---|
| Preferred name | rmlC |
| eggNOG description | Catalyzes the epimerization of the C3' and C5'positions of dTDP-6-deoxy-D-xylo-4-hexulose, forming dTDP-6-deoxy-L-lyxo-4- hexulose |
| Orthologous group | COG1898 |
| EC number |
EC 5.1.3.13
|
| KEGG orthology |
K01790
|
| KEGG pathways |
map00521, map00523, map01130
|
| KEGG modules |
M00793
|
| Gene Ontology (49) |
GO:0000271, GO:0003674, GO:0003824, GO:0005975, GO:0005976, GO:0006139, GO:0006725, GO:0006807, GO:0008150, GO:0008152, GO:0008830, GO:0009058 +37 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.272 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 6 consensus substitution(s) low power (6 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 81.9%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 9/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 45.9% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 9 in the ORF — 8 in the essential state, 1 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.111, mean read count 16. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | rmlC-TetOn18 (TetON promoter 18) |
|---|---|
| Baseline knockdown fitness | 4.381 median doublings (across 1 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | no (Excluded - not in all screening waves) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 286.0 ppm · rank 667/3519 (81.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 202 aa |
|---|---|
| Molecular weight | 22.3 kDa |
| Theoretical pI | 4.93 |
| GRAVY | -0.177 (hydrophilic) |
| Aliphatic index | 81.1 |
| Aromaticity | 0.094 |
| Instability index | 35.2 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
dTDP_sugar_isom | PF00908.24 | 1.0e-60 | 6–179 | dTDP-4-dehydrorhamnose 3,5-epimerase |
Experimental structures (Protein Data Bank) 3 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
1upi |
X-ray diffraction | 1.7 Å | 100% |
2ixc |
X-ray diffraction | 1.79 Å | 100% |
1pm7 |
X-ray diffraction | 2.2 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (3 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
1upi-assembly1_A |
1.00 | 1.00 | 6.6e-40 sig | 1upi-assembly1_A Mycobacterium tuberculosis rmlC epimerase (Rv3465) |
7pwh-assembly1_AAA |
1.00 | 0.96 | 1.2e-28 sig | 7pwh-assembly1_AAA Structure of the dTDP-sugar epimerase StrM |
2c0z-assembly1_A-2 |
1.00 | 0.97 | 7.8e-27 sig | 2c0z-assembly1_A-2 The 1.6 A resolution crystal structure of NovW: a 4-keto-6-deoxy sugar epimerase from the novobiocin biosynthetic gene cluster of Streptomyces spheroides |
4hn1-assembly1_B |
1.00 | 0.96 | 2.3e-27 sig | 4hn1-assembly1_B Crystal Structure of H60N/Y130F double mutant of ChmJ, a 3'-monoepimerase from Streptomyces bikiniensis in complex with dTDP |
4hmz-assembly1_A |
1.00 | 0.96 | 8.0e-26 sig | 4hmz-assembly1_A Crystal Structure of ChmJ, a 3'-monoepimerase from Streptomyces bikiniensis in complex with dTDP-quinovose |
Foldseek search of the AlphaFold DB model (mean pLDDT 97.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | rmlB (+ strand, 1 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3466 (+ strand, 82 bp gap) |
| Predicted operon |
rmlB · rmlC
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: rmlD (dTDP-4-dehydrorhamnose reductase), high confidence from genomic context alone (score 999 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3266c rmlD exp |
dTDP-4-dehydrorhamnose reductase | 999 | 999 ctx | fusion:837 cooccurence:773 coexpression:857 database:900 textmining:949 |
Rv3464 rmlB exp |
dTDP-glucose 4,6-dehydratase | 999 | 999 ctx | neighborhood:882 fusion:460 cooccurence:663 coexpression:742 database:900 textmining:965 |
Rv0334 rmlA |
glucose-1-phosphate thymidylyltransferase | 999 | 992 ctx | fusion:715 cooccurence:763 coexpression:858 textmining:963 |
Rv3784 exp |
dTDP-glucose 4,6-dehydratase | 987 | 980 | coexpression:731 database:900 |
Rv0536 galE3 exp |
UDP-glucose 4-epimerase GalE | 887 | 881 | coexpression:409 database:800 |
Rv1510 hyp |
hypothetical protein | 901 | 873 | coexpression:856 |
Rv0322 udgA |
UDP-glucose 6-dehydrogenase UdgA | 899 | 868 | coexpression:857 |
Rv3809c glf |
UDP-galactopyranose mutase | 911 | 864 | coexpression:853 |
Rv3265c wbbL1 |
N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase | 930 | 806 ctx | cooccurence:712 textmining:659 |
Rv3264c manB |
D-alpha-D-mannose-1-phosphate guanylyltransferase ManB | 846 | 800 | coexpression:783 |
Rv3463 hyp |
hypothetical protein | 791 | 791 ctx | neighborhood:790 |
Rv3630 |
integral membrane protein | 774 | 744 | coexpression:729 |
Rv3468c exp |
dTDP-glucose 4,6-dehydratase | 781 | 703 | coexpression:411 database:500 |
Rv3462c infA |
translation initiation factor IF-1 | 687 | 688 ctx | neighborhood:680 |
Rv0115 hddA |
D-alpha-D-heptose-7-phosphate kinase HddA | 596 | 581 | coexpression:546 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: dTDP-4-dehydrorhamnose 3,5-epimerase
- MTBC0 PGAP product: dTDP-4-dehydrorhamnose 3%2C5-epimerase
- Pfam (hmmscan --cut_ga): dTDP_sugar_isom PF00908.24 (E=1e-60)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217982.1)
- Domains: Pfam-A via hmmscan --cut_ga — dTDP_sugar_isom (PF00908.24)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1898 - Curated reference: UniProt P9WH11 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
59 functional partner(s); context anchor
rmlD - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003683|Rv3465|rmlC MKARELDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLDVRQVNCSVSSAGVLRGLHFAQLPPSQAKYVTCVSGSVFDVVVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHGFLALQDNSTVMYLCSAEYNPQREHTICATDPTLAVDWPLVDGAAPSLSDRDAAAPSFEDVRASGLLPRWEQTQRFIGEMRGT
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for rmlC? Email the maintainer — the message is pre-filled with this gene's details.