rmlC Resolved · high auto-curated

H37Rv Rv3465 · MTBC0 mtbc0_003683 · 202 aa · 3908774–3909382 (+) · RefSeq NP_217982.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)dTDP-4-dehydrorhamnose 3,5-epimerase
MTBC0 PGAP re-annotationdTDP-4-dehydrorhamnose 3%2C5-epimerase
Revised (this work)DTDP-4-dehydrorhamnose 3%2C5-epimerase. Pfam: dTDP_sugar_isom (PF00908.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WH11 SwissProt · reviewed · Evidence at protein level
UniProt namedTDP-4-dehydrorhamnose 3,5-epimerase
EC (curated) EC 5.1.3.13
Curated functionCatalyzes the epimerization of the C3' and C5'positions of dTDP-6-deoxy-D-xylo-4-hexulose, forming dTDP-6-deoxy-L-lyxo-4-hexulose. Involved in the biosynthesis of the dTDP-L-rhamnose which is a component of the critical linker, D-N-acetylglucosamine-L-rhamnose disaccharide, which connects the galactan region of arabinogalactan to peptidoglycan via a phosphodiester linkage.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namermlC
eggNOG descriptionCatalyzes the epimerization of the C3' and C5'positions of dTDP-6-deoxy-D-xylo-4-hexulose, forming dTDP-6-deoxy-L-lyxo-4- hexulose
Orthologous groupCOG1898
EC number EC 5.1.3.13
KEGG orthology K01790
KEGG pathways map00521, map00523, map01130
KEGG modules M00793
Gene Ontology (49) GO:0000271, GO:0003674, GO:0003824, GO:0005975, GO:0005976, GO:0006139, GO:0006725, GO:0006807, GO:0008150, GO:0008152, GO:0008830, GO:0009058 +37 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.272 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
dTDP_sugar_isomPF00908.24 1.0e-606–179 dTDP-4-dehydrorhamnose 3,5-epimerase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rmlD (dTDP-4-dehydrorhamnose reductase), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3266c rmlD dTDP-4-dehydrorhamnose reductase 999 999 ctx fusion:837 cooccurence:773 coexpression:857 database:900 textmining:949
Rv3464 rmlB dTDP-glucose 4,6-dehydratase 999 999 ctx neighborhood:882 fusion:460 cooccurence:663 coexpression:742 database:900 textmining:965
Rv0334 rmlA glucose-1-phosphate thymidylyltransferase 999 992 ctx fusion:715 cooccurence:763 coexpression:858 textmining:963
Rv3784 dTDP-glucose 4,6-dehydratase 987 980 coexpression:731 database:900
Rv0536 galE3 UDP-glucose 4-epimerase GalE 887 881 coexpression:409 database:800
Rv1510 hyp hypothetical protein 901 873 coexpression:856
Rv0322 udgA UDP-glucose 6-dehydrogenase UdgA 899 868 coexpression:857
Rv3809c glf UDP-galactopyranose mutase 911 864 coexpression:853
Rv3265c wbbL1 N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase 930 806 ctx cooccurence:712 textmining:659
Rv3264c manB D-alpha-D-mannose-1-phosphate guanylyltransferase ManB 846 800 coexpression:783
Rv3463 hyp hypothetical protein 791 791 ctx neighborhood:790
Rv3630 integral membrane protein 774 744 coexpression:729
Rv3468c dTDP-glucose 4,6-dehydratase 781 703 coexpression:411 database:500
Rv3462c infA translation initiation factor IF-1 687 688 ctx neighborhood:680
Rv0115 hddA D-alpha-D-heptose-7-phosphate kinase HddA 596 581 coexpression:546

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: dTDP-4-dehydrorhamnose 3,5-epimerase
  • MTBC0 PGAP product: dTDP-4-dehydrorhamnose 3%2C5-epimerase
  • Pfam (hmmscan --cut_ga): dTDP_sugar_isom PF00908.24 (E=1e-60)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217982.1)
  • Domains: Pfam-A via hmmscan --cut_ga — dTDP_sugar_isom (PF00908.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1898
  • Curated reference: UniProt P9WH11 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 59 functional partner(s); context anchor rmlD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003683|Rv3465|rmlC
MKARELDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLDVRQVNCSVSSAGVLRGLHFAQLPPSQAKYVTCVSGSVFDVVVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHGFLALQDNSTVMYLCSAEYNPQREHTICATDPTLAVDWPLVDGAAPSLSDRDAAAPSFEDVRASGLLPRWEQTQRFIGEMRGT