Rv1515c Family assigned · medium auto-curated

H37Rv Rv1515c · MTBC0 mtbc0_001622 · 298 aa · 1716439–1717335 (-) · RefSeq NP_216031.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationmethyltransferase domain-containing protein
Revised (this work)Methyltransferase domain-containing protein. Pfam: Methyltransf_23 (PF13489.13), Methyltransf_31 (PF13847.13), Methyltransf_11 (PF08241.19), Methyltransf_25 (PF13649.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71794 TrEMBL · unreviewed · Evidence at protein level
UniProt nameMethyltransferase type 11 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
eggNOG descriptionMethyltransferase domain
Orthologous groupCOG2227

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.783 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Methyltransf_23PF13489.13 2.6e-0760–264 Methyltransferase domain
Methyltransf_31PF13847.13 8.1e-0768–163 Methyltransferase domain
Methyltransf_11PF08241.19 5.1e-0875–161 Methyltransferase domain
Methyltransf_25PF13649.13 1.4e-0775–161 Methyltransferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1516c (sugar transferase), high confidence from genomic context alone (score 976 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1516c sugar transferase 976 976 ctx neighborhood:882 coexpression:806
Rv2357c glyS glycine--tRNA ligase 793 794 coexpression:793
Rv1514c glycosyltransferase 787 787 ctx neighborhood:712
Rv1518 hyp hypothetical protein 404 401 ctx neighborhood:401
Rv1432 dehydrogenase 418 395

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: methyltransferase domain-containing protein
  • Pfam (hmmscan --cut_ga): Methyltransf_23 PF13489.13 (E=3e-07), Methyltransf_31 PF13847.13 (E=8e-07), Methyltransf_11 PF08241.19 (E=5e-08), Methyltransf_25 PF13649.13 (E=1e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216031.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Methyltransf_23 (PF13489.13), Methyltransf_31 (PF13847.13), Methyltransf_11 (PF08241.19), Methyltransf_25 (PF13649.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2227
  • Curated reference: UniProt P71794 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 5 functional partner(s); context anchor Rv1516c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001622|Rv1515c|
MSTNPGPAEGANQVMAQEHSAGAVQFTAHNVRLDDGTLTIPESSRTLDESSWFISARGILETVFPGDKSHLRLADVGCLEGGYAVGFARMGFQVLGIEVRELNMAACNYIKSKTNLPNLRFVHDNALNIANHGLFDTVFCCGLFYHLENPKQYLETLSSVTNKLLILQTHFSIINRSDKWLRLPTTARQLTDRLLRRPAPVKFMLSAPTEHEGLPGRWFTEFSDDRSFGQRDTAKWASWDNRRSFWIQREHLLQAIKDVGFDLVMEEYDNLEPSIAESLLGGSYAANLRGTFIGIKTR