gmdA Resolved · high auto-curated

H37Rv Rv1511 · MTBC0 mtbc0_001614 · 40 aa · 1709768–1709887 (+) · RefSeq NP_216027.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)GDP-D-mannose dehydratase GmdA
MTBC0 PGAP re-annotationGDP-mannose 4%2C6-dehydratase
Revised (this work)GDP-mannose 4%2C6-dehydratase. Pfam: Epimerase (PF01370.28), GDP_Man_Dehyd (PF16363.12).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71790 TrEMBL · unreviewed · Evidence at protein level
UniProt nameGDP-mannose 4,6-dehydratase
EC (curated) EC 4.2.1.47
Curated functionCatalyzes the conversion of GDP-D-mannose to GDP-4-dehydro-6-deoxy-D-mannose.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namegmd
eggNOG descriptionGDP-mannose 4,6-dehydratase activity
Orthologous groupCOG1089
EC number EC 4.2.1.47
KEGG orthology K01711
KEGG pathways map00051, map00520, map01100

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.439 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.12% of strains (180) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
EpimerasePF01370.28 1.7e-704–247 NAD dependent epimerase/dehydratase family
GDP_Man_DehydPF16363.12 1.2e-1355–315 GDP-mannose 4,6 dehydratase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: epiA (nucleotide-sugar epimerase EpiA), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1512 epiA nucleotide-sugar epimerase EpiA 999 999 ctx neighborhood:882 fusion:723 cooccurence:772 database:900 textmining:812
Rv0112 gca GDP-mannose 4,6-dehydratase 956 955 database:900
Rv3264c manB D-alpha-D-mannose-1-phosphate guanylyltransferase ManB 914 906 database:900
Rv1513 hyp hypothetical protein 932 803 ctx neighborhood:801 textmining:668
Rv0702 rplD 50S ribosomal protein L4 677 677 ctx fusion:674
Rv1514c glycosyltransferase 682 671 ctx cooccurence:622
Rv3725 oxidoreductase 448 422
Rv0139 oxidoreductase 446 419
Rv1106c 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase 444 418
Rv0501 galE2 UDP-glucose 4-epimerase GalE 444 418
Rv3468c dTDP-glucose 4,6-dehydratase 444 418
Rv1868 hyp hypothetical protein 444 418
Rv3634c galE1 UDP-glucose 4-epimerase 444 418
Rv2047c hyp hypothetical protein 444 418
Rv0536 galE3 UDP-glucose 4-epimerase GalE 442 416

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: GDP-D-mannose dehydratase GmdA
  • MTBC0 PGAP product: GDP-mannose 4%2C6-dehydratase
  • Pfam (hmmscan --cut_ga): Epimerase PF01370.28 (E=2e-70), GDP_Man_Dehyd PF16363.12 (E=1e-135)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216027.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Epimerase (PF01370.28), GDP_Man_Dehyd (PF16363.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1089
  • Curated reference: UniProt P71790 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 35 functional partner(s); context anchor epiA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001614|Rv1511|gmdA
MEVYFCWATRNYRELYGLLAVNSIWFNHESPRHGETFMTR