rmlA Resolved · high auto-curated

H37Rv Rv0334 · MTBC0 mtbc0_000354 · 288 aa · 401981–402847 MTBC0 (+) · RefSeq NP_214848.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)glucose-1-phosphate thymidylyltransferase
MTBC0 PGAP re-annotationglucose-1-phosphate thymidylyltransferase RfbA
Revised (this work)Glucose-1-phosphate thymidylyltransferase RfbA. Pfam: NTP_transferase (PF00483.30), NTP_transf_3 (PF12804.14).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 15 publications

15 TB publications mention this gene. 15 publication(s) discuss this gene (13 in a M. tuberculosis context, 3 in other mycobacteria — M. smegmatis (3)).

Most recent 5 of 15.
PublicationDate
Rhamnose-Containing Compounds: Biosynthesis and Applications. doi:10.3390/molecules27165315 2022
The effects of mycobacterial RmlA perturbation on cellular dNTP pool, cell morphology, and replication stress in Mycobacterium smegmatis. doi:10.1371/journal.pone.0263975 2022
Practical approach to detection and surveillance of emerging highly resistant Mycobacterium tuberculosis Beijing 1071-32-cluster. doi:10.1038/s41598-021-00890-7 2021
Mycobacterium tuberculosis Thymidylyltransferase RmlA Is Negatively Regulated by Ser/Thr Protein Kinase PknB. doi:10.3389/fmicb.2021.643951 2021
A structural and functional perspective on the enzymes of Mycobacterium tuberculosis involved in the L-rhamnose biosynthesis pathway. doi:10.1016/j.pbiomolbio.2018.12.004 2019

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Post-translational modifications

3 reported modified residue(s), incl. 3 phosphosite(s): Phosphothreonine; by PknB @12, Phosphothreonine; by PknB @54, Phosphothreonine; by PknB @197.

Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).

CRISPRi vulnerability

Vulnerability index -2.50 (95% CI -2.88 to -2.15). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functiondTDP-L-rhamnose biosynthesis within the O antigen biosynthesis pathway of lipopolysaccharide biosynthesis [catalytic activity: dTTP + alpha-D-glucose 1-phosphate = diphosphate + dTDP-glucose].
Mycobrowser EC 2.7.7.24 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0341 · 100.0% identity
M. leprae ML2503c · 87.1% identity
M. marinum MMAR_0606 · 91.3% identity
M. smegmatis MSMEG_0384 · 79.1% identity
M. orygis RJtmp_000350 · 100.0% identity
M. abscessus MAB_4113 · 77.7% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WH13 SwissProt · reviewed · Evidence at protein level
UniProt nameGlucose-1-phosphate thymidylyltransferase
EC (curated) EC 2.7.7.24
Curated functionCatalyzes the conversion of glucose-1-phosphate and dTTP to dTDP-glucose and pyrophosphate. Involved in the biosynthesis of the dTDP-L-rhamnose which is a component of the critical linker, D-N-acetylglucosamine-L-rhamnose disaccharide, which connects the galactan region of arabinogalactan to peptidoglycan via a phosphodiester linkage.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namermlA
eggNOG descriptionCatalyzes the formation of dTDP-glucose, from dTTP and glucose 1-phosphate, as well as its pyrophosphorolysis
Orthologous groupCOG1209
EC number EC 2.7.7.24
KEGG orthology K00973
KEGG pathways map00521, map00523, map00525, map01130
KEGG modules M00793
Gene Ontology (82) GO:0000271, GO:0000287, GO:0003674, GO:0003824, GO:0005488, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0005975, GO:0005976, GO:0005996 +70 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 2 consensus substitution(s)
low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 86.0% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 61.7%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) essential

DeJesus 2017 callES · essential
What the call meansessential: insertions absent across the whole ORF
TA sites (Himar1) 19 in the ORF — 19 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 12 of 16 independent MS datasets
Integrated abundance103.0 ppm · rank 1276/3519 (63.8th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length288 aa
Molecular weight31.5 kDa
Theoretical pI5.3
GRAVY0.008 (hydrophobic)
Aliphatic index99.9
Aromaticity0.097
Instability index31.4 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NTP_transferasePF00483.30 4.7e-743–236 Nucleotidyl transferase
NTP_transf_3PF12804.14 3.9e-093–122 MobA-like NTP transferase domain

Experimental structures (Protein Data Bank) 2 solved

PDBMethodResolutionCoverage
6b5k X-ray diffraction 1.6 Å 100%
6b5e X-ray diffraction 1.85 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (2 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.5

PDB hitprobTM-scoreE-valueDescription
6b5e-assembly1_A 1.00 0.99 3.7e-56 sig 6b5e-assembly1_A Mycobacterium tuberculosis RmlA in complex with dTDP-glucose
6b5e-assembly2_E 1.00 0.99 6.3e-56 sig 6b5e-assembly2_E Mycobacterium tuberculosis RmlA in complex with dTDP-glucose
6b5e-assembly2_G 1.00 0.98 1.0e-55 sig 6b5e-assembly2_G Mycobacterium tuberculosis RmlA in complex with dTDP-glucose
6b5e-assembly1_H 1.00 0.98 3.1e-53 sig 6b5e-assembly1_H Mycobacterium tuberculosis RmlA in complex with dTDP-glucose
6b5k-assembly1_A-2 1.00 0.98 3.1e-52 sig 6b5k-assembly1_A-2 Mycobacterium tuberculosis RmlA in complex with Mg/dTTP

Foldseek search of the AlphaFold DB model (mean pLDDT 95.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 3

Upstream (5' on genome)Rv0333 (+ strand, 29 bp gap)
Downstream (3' on genome)PE6 (- strand, 10 bp gap)
Predicted operon Rv0332 · Rv0333 · rmlA

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: rmlB (dTDP-glucose 4,6-dehydratase), high confidence from genomic context alone (score 995 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3464 rmlB exp dTDP-glucose 4,6-dehydratase 999 995 ctx cooccurence:772 coexpression:734 database:900 textmining:965
Rv3465 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase 999 992 ctx fusion:715 cooccurence:763 coexpression:858 textmining:963
Rv3784 exp dTDP-glucose 4,6-dehydratase 991 985 ctx cooccurence:435 coexpression:733 database:900 textmining:415
Rv3266c rmlD dTDP-4-dehydrorhamnose reductase 998 969 ctx cooccurence:763 coexpression:853 textmining:963
Rv0322 udgA UDP-glucose 6-dehydrogenase UdgA 958 932 ctx neighborhood:544 coexpression:857 textmining:417
Rv0993 galU exp UTP--glucose-1-phosphate uridylyltransferase 927 915 database:900
Rv3068c pgmA exp phosphoglucomutase PgmA 914 906 database:900
Rv1510 hyp hypothetical protein 901 886 coexpression:858
Rv3809c glf UDP-galactopyranose mutase 910 870 coexpression:859
Rv0333 hyp hypothetical protein 840 840 ctx neighborhood:838
Rv0332 hyp hypothetical protein 818 811 ctx neighborhood:805
Rv3264c manB D-alpha-D-mannose-1-phosphate guanylyltransferase ManB 785 753 coexpression:733
Rv3630 integral membrane protein 773 745 coexpression:730
Rv3265c wbbL1 N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase 893 665 ctx cooccurence:525 textmining:696
Rv3468c exp dTDP-glucose 4,6-dehydratase 664 645 database:500

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: glucose-1-phosphate thymidylyltransferase
  • MTBC0 PGAP product: glucose-1-phosphate thymidylyltransferase RfbA
  • Pfam (hmmscan --cut_ga): NTP_transferase PF00483.30 (E=5e-74), NTP_transf_3 PF12804.14 (E=4e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214848.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NTP_transferase (PF00483.30), NTP_transf_3 (PF12804.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1209
  • Curated reference: UniProt P9WH13 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.5)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 51 functional partner(s); context anchor rmlB
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000354|Rv0334|rmlA
MRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAGIRDIQLITTPHDAPGFHRLLGDGAHLGVNISYATQDQPDGLAQAFVIGANHIGADSVALVLGDNIFYGPGLGTSLKRFQSISGGAIFAYWVANPSAYGVVEFGAEGMALSLEEKPVTPKSNYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVNQVYLNQGRLAVEVLARGTAWLDTGTFDSLLDAADFVRTLERRQGLKVSIPEEVAWRMGWIDDEQLVQRARALVKSGYGNYLLELLERN