rmlA Resolved · high auto-curated
H37Rv Rv0334 · MTBC0 mtbc0_000354 ·
288 aa ·
401981–402847 MTBC0
(+) ·
RefSeq NP_214848.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | glucose-1-phosphate thymidylyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | glucose-1-phosphate thymidylyltransferase RfbA |
| Revised (this work) | Glucose-1-phosphate thymidylyltransferase RfbA. Pfam: NTP_transferase (PF00483.30), NTP_transf_3 (PF12804.14). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 15 publications
15 TB publications mention this gene. 15 publication(s) discuss this gene (13 in a M. tuberculosis context, 3 in other mycobacteria — M. smegmatis (3)).
| Publication | Date |
|---|---|
| Rhamnose-Containing Compounds: Biosynthesis and Applications. doi:10.3390/molecules27165315 | 2022 |
| The effects of mycobacterial RmlA perturbation on cellular dNTP pool, cell morphology, and replication stress in Mycobacterium smegmatis. doi:10.1371/journal.pone.0263975 | 2022 |
| Practical approach to detection and surveillance of emerging highly resistant Mycobacterium tuberculosis Beijing 1071-32-cluster. doi:10.1038/s41598-021-00890-7 | 2021 |
| Mycobacterium tuberculosis Thymidylyltransferase RmlA Is Negatively Regulated by Ser/Thr Protein Kinase PknB. doi:10.3389/fmicb.2021.643951 | 2021 |
| A structural and functional perspective on the enzymes of Mycobacterium tuberculosis involved in the L-rhamnose biosynthesis pathway. doi:10.1016/j.pbiomolbio.2018.12.004 | 2019 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Post-translational modifications
3 reported modified residue(s), incl. 3 phosphosite(s):
Phosphothreonine; by PknB @12, Phosphothreonine; by PknB @54, Phosphothreonine; by PknB @197.
Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).
CRISPRi vulnerability
Vulnerability index -2.50 (95% CI -2.88 to -2.15). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | dTDP-L-rhamnose biosynthesis within the O antigen biosynthesis pathway of lipopolysaccharide biosynthesis [catalytic activity: dTTP + alpha-D-glucose 1-phosphate = diphosphate + dTDP-glucose]. |
|---|---|
| Mycobrowser EC |
2.7.7.24
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0341
· 100.0% identity |
|---|---|
| M. leprae |
ML2503c
· 87.1% identity |
| M. marinum |
MMAR_0606
· 91.3% identity |
| M. smegmatis |
MSMEG_0384
· 79.1% identity |
| M. orygis |
RJtmp_000350
· 100.0% identity |
| M. abscessus |
MAB_4113
· 77.7% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WH13
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Glucose-1-phosphate thymidylyltransferase |
| EC (curated) |
EC 2.7.7.24
|
| Curated function | Catalyzes the conversion of glucose-1-phosphate and dTTP to dTDP-glucose and pyrophosphate. Involved in the biosynthesis of the dTDP-L-rhamnose which is a component of the critical linker, D-N-acetylglucosamine-L-rhamnose disaccharide, which connects the galactan region of arabinogalactan to peptidoglycan via a phosphodiester linkage. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
M Cell wall / membrane / envelope biogenesis
|
|---|---|
| Preferred name | rmlA |
| eggNOG description | Catalyzes the formation of dTDP-glucose, from dTTP and glucose 1-phosphate, as well as its pyrophosphorolysis |
| Orthologous group | COG1209 |
| EC number |
EC 2.7.7.24
|
| KEGG orthology |
K00973
|
| KEGG pathways |
map00521, map00523, map00525, map01130
|
| KEGG modules |
M00793
|
| Gene Ontology (82) |
GO:0000271, GO:0000287, GO:0003674, GO:0003824, GO:0005488, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0005975, GO:0005976, GO:0005996 +70 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 86.0%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 61.7% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 19 in the ORF — 19 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 12 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 103.0 ppm · rank 1276/3519 (63.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 288 aa |
|---|---|
| Molecular weight | 31.5 kDa |
| Theoretical pI | 5.3 |
| GRAVY | 0.008 (hydrophobic) |
| Aliphatic index | 99.9 |
| Aromaticity | 0.097 |
| Instability index | 31.4 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
NTP_transferase | PF00483.30 | 4.7e-74 | 3–236 | Nucleotidyl transferase |
NTP_transf_3 | PF12804.14 | 3.9e-09 | 3–122 | MobA-like NTP transferase domain |
Experimental structures (Protein Data Bank) 2 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
6b5k |
X-ray diffraction | 1.6 Å | 100% |
6b5e |
X-ray diffraction | 1.85 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (2 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.5
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6b5e-assembly1_A |
1.00 | 0.99 | 3.7e-56 sig | 6b5e-assembly1_A Mycobacterium tuberculosis RmlA in complex with dTDP-glucose |
6b5e-assembly2_E |
1.00 | 0.99 | 6.3e-56 sig | 6b5e-assembly2_E Mycobacterium tuberculosis RmlA in complex with dTDP-glucose |
6b5e-assembly2_G |
1.00 | 0.98 | 1.0e-55 sig | 6b5e-assembly2_G Mycobacterium tuberculosis RmlA in complex with dTDP-glucose |
6b5e-assembly1_H |
1.00 | 0.98 | 3.1e-53 sig | 6b5e-assembly1_H Mycobacterium tuberculosis RmlA in complex with dTDP-glucose |
6b5k-assembly1_A-2 |
1.00 | 0.98 | 3.1e-52 sig | 6b5k-assembly1_A-2 Mycobacterium tuberculosis RmlA in complex with Mg/dTTP |
Foldseek search of the AlphaFold DB model (mean pLDDT 95.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | Rv0333 (+ strand, 29 bp gap) |
|---|---|
| Downstream (3' on genome) | PE6 (- strand, 10 bp gap) |
| Predicted operon |
Rv0332 · Rv0333 · rmlA
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: rmlB (dTDP-glucose 4,6-dehydratase), high confidence from genomic context alone (score 995 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3464 rmlB exp |
dTDP-glucose 4,6-dehydratase | 999 | 995 ctx | cooccurence:772 coexpression:734 database:900 textmining:965 |
Rv3465 rmlC |
dTDP-4-dehydrorhamnose 3,5-epimerase | 999 | 992 ctx | fusion:715 cooccurence:763 coexpression:858 textmining:963 |
Rv3784 exp |
dTDP-glucose 4,6-dehydratase | 991 | 985 ctx | cooccurence:435 coexpression:733 database:900 textmining:415 |
Rv3266c rmlD |
dTDP-4-dehydrorhamnose reductase | 998 | 969 ctx | cooccurence:763 coexpression:853 textmining:963 |
Rv0322 udgA |
UDP-glucose 6-dehydrogenase UdgA | 958 | 932 ctx | neighborhood:544 coexpression:857 textmining:417 |
Rv0993 galU exp |
UTP--glucose-1-phosphate uridylyltransferase | 927 | 915 | database:900 |
Rv3068c pgmA exp |
phosphoglucomutase PgmA | 914 | 906 | database:900 |
Rv1510 hyp |
hypothetical protein | 901 | 886 | coexpression:858 |
Rv3809c glf |
UDP-galactopyranose mutase | 910 | 870 | coexpression:859 |
Rv0333 hyp |
hypothetical protein | 840 | 840 ctx | neighborhood:838 |
Rv0332 hyp |
hypothetical protein | 818 | 811 ctx | neighborhood:805 |
Rv3264c manB |
D-alpha-D-mannose-1-phosphate guanylyltransferase ManB | 785 | 753 | coexpression:733 |
Rv3630 |
integral membrane protein | 773 | 745 | coexpression:730 |
Rv3265c wbbL1 |
N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase | 893 | 665 ctx | cooccurence:525 textmining:696 |
Rv3468c exp |
dTDP-glucose 4,6-dehydratase | 664 | 645 | database:500 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: glucose-1-phosphate thymidylyltransferase
- MTBC0 PGAP product: glucose-1-phosphate thymidylyltransferase RfbA
- Pfam (hmmscan --cut_ga): NTP_transferase PF00483.30 (E=5e-74), NTP_transf_3 PF12804.14 (E=4e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214848.1)
- Domains: Pfam-A via hmmscan --cut_ga — NTP_transferase (PF00483.30), NTP_transf_3 (PF12804.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1209 - Curated reference: UniProt P9WH13 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.5)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
51 functional partner(s); context anchor
rmlB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000354|Rv0334|rmlA MRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAGIRDIQLITTPHDAPGFHRLLGDGAHLGVNISYATQDQPDGLAQAFVIGANHIGADSVALVLGDNIFYGPGLGTSLKRFQSISGGAIFAYWVANPSAYGVVEFGAEGMALSLEEKPVTPKSNYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVNQVYLNQGRLAVEVLARGTAWLDTGTFDSLLDAADFVRTLERRQGLKVSIPEEVAWRMGWIDDEQLVQRARALVKSGYGNYLLELLERN
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for rmlA? Email the maintainer — the message is pre-filled with this gene's details.