rmlA Resolved · high auto-curated

H37Rv Rv0334 · MTBC0 mtbc0_000354 · 288 aa · 401981–402847 (+) · RefSeq NP_214848.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)glucose-1-phosphate thymidylyltransferase
MTBC0 PGAP re-annotationglucose-1-phosphate thymidylyltransferase RfbA
Revised (this work)Glucose-1-phosphate thymidylyltransferase RfbA. Pfam: NTP_transferase (PF00483.30), NTP_transf_3 (PF12804.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WH13 SwissProt · reviewed · Evidence at protein level
UniProt nameGlucose-1-phosphate thymidylyltransferase
EC (curated) EC 2.7.7.24
Curated functionCatalyzes the conversion of glucose-1-phosphate and dTTP to dTDP-glucose and pyrophosphate. Involved in the biosynthesis of the dTDP-L-rhamnose which is a component of the critical linker, D-N-acetylglucosamine-L-rhamnose disaccharide, which connects the galactan region of arabinogalactan to peptidoglycan via a phosphodiester linkage.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namermlA
eggNOG descriptionCatalyzes the formation of dTDP-glucose, from dTTP and glucose 1-phosphate, as well as its pyrophosphorolysis
Orthologous groupCOG1209
EC number EC 2.7.7.24
KEGG orthology K00973
KEGG pathways map00521, map00523, map00525, map01130
KEGG modules M00793
Gene Ontology (82) GO:0000271, GO:0000287, GO:0003674, GO:0003824, GO:0005488, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0005975, GO:0005976, GO:0005996 +70 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NTP_transferasePF00483.30 4.7e-743–236 Nucleotidyl transferase
NTP_transf_3PF12804.14 3.9e-093–122 MobA-like NTP transferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rmlB (dTDP-glucose 4,6-dehydratase), high confidence from genomic context alone (score 995 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3464 rmlB dTDP-glucose 4,6-dehydratase 999 995 ctx cooccurence:772 coexpression:734 database:900 textmining:965
Rv3465 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase 999 992 ctx fusion:715 cooccurence:763 coexpression:858 textmining:963
Rv3784 dTDP-glucose 4,6-dehydratase 991 985 ctx cooccurence:435 coexpression:733 database:900 textmining:415
Rv3266c rmlD dTDP-4-dehydrorhamnose reductase 998 969 ctx cooccurence:763 coexpression:853 textmining:963
Rv0322 udgA UDP-glucose 6-dehydrogenase UdgA 958 932 ctx neighborhood:544 coexpression:857 textmining:417
Rv0993 galU UTP--glucose-1-phosphate uridylyltransferase 927 915 database:900
Rv3068c pgmA phosphoglucomutase PgmA 914 906 database:900
Rv1510 hyp hypothetical protein 901 886 coexpression:858
Rv3809c glf UDP-galactopyranose mutase 910 870 coexpression:859
Rv0333 hyp hypothetical protein 840 840 ctx neighborhood:838
Rv0332 hyp hypothetical protein 818 811 ctx neighborhood:805
Rv3264c manB D-alpha-D-mannose-1-phosphate guanylyltransferase ManB 785 753 coexpression:733
Rv3630 integral membrane protein 773 745 coexpression:730
Rv3265c wbbL1 N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase 893 665 ctx cooccurence:525 textmining:696
Rv3468c dTDP-glucose 4,6-dehydratase 664 645 database:500

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: glucose-1-phosphate thymidylyltransferase
  • MTBC0 PGAP product: glucose-1-phosphate thymidylyltransferase RfbA
  • Pfam (hmmscan --cut_ga): NTP_transferase PF00483.30 (E=5e-74), NTP_transf_3 PF12804.14 (E=4e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214848.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NTP_transferase (PF00483.30), NTP_transf_3 (PF12804.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1209
  • Curated reference: UniProt P9WH13 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 51 functional partner(s); context anchor rmlB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000354|Rv0334|rmlA
MRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAGIRDIQLITTPHDAPGFHRLLGDGAHLGVNISYATQDQPDGLAQAFVIGANHIGADSVALVLGDNIFYGPGLGTSLKRFQSISGGAIFAYWVANPSAYGVVEFGAEGMALSLEEKPVTPKSNYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVNQVYLNQGRLAVEVLARGTAWLDTGTFDSLLDAADFVRTLERRQGLKVSIPEEVAWRMGWIDDEQLVQRARALVKSGYGNYLLELLERN