pyrR Family assigned · medium auto-curated
H37Rv Rv1379 · MTBC0 mtbc0_001480 ·
193 aa ·
1561998–1562579 MTBC0
(+) ·
RefSeq NP_215895.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | bifunctional pyrimidine operon regulatory protein/uracil phosphoribosyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR |
| Revised (this work) | Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR. Pfam: Pribosyltran (PF00156.34). |
| Functional category (TubercuList) | regulatory proteins |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 5 publications
5 TB publications mention this gene. 5 publication(s) discuss this gene (3 in a M. tuberculosis context, 2 in other mycobacteria — M. smegmatis (2)).
| Publication | Date |
|---|---|
| Structure and mapping of spontaneous mutational sites of PyrR from Mycobacterium tuberculosis. doi:10.1016/j.bbrc.2016.02.071 | 2016 |
| The complex mechanism of antimycobacterial action of 5-fluorouracil. doi:10.1016/j.chembiol.2014.11.006 | 2015 |
| Regulation of pyrimidine biosynthetic gene expression in bacteria: repression without repressors. doi:10.1128/MMBR.00001-08 | 2008 |
| Regulation of pyr gene expression in Mycobacterium smegmatis by PyrR-dependent translational repression. doi:10.1128/JB.00803-07 | 2007 |
| Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. doi:10.1107/S090744490403389X | 2005 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | pyrB (Rv1380, + strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -10.89 (95% CI -16.01 to -4.89). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Binds to the conserved sequence in the PYR operon mRNA and disrupts the antiterminator, permitting terminator hairpin formation and promoting transcription termination |
|---|---|
| Mycobrowser EC |
2.4.2.9
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1414
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_2194
· 85.0% identity |
| M. smegmatis |
MSMEG_3042
· 82.8% identity |
| M. orygis |
RJtmp_001459
· 100.0% identity |
| M. abscessus |
MAB_2832c
· 78.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WHK3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase |
| EC (curated) |
EC 2.4.2.9
|
| Curated function | Regulates the transcription of the pyrimidine nucleotide (pyr) operon in response to exogenous pyrimidines..; FUNCTION: Also displays a weak uracil phosphoribosyltransferase activity which is not physiologically significant. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolism
|
|---|---|
| Preferred name | pyrR |
| eggNOG description | Also displays a weak uracil phosphoribosyltransferase activity which is not physiologically significant |
| Orthologous group | COG2065 |
| EC number |
EC 2.4.2.9
|
| KEGG orthology |
K02825
|
| KEGG pathways |
map00240, map01100
|
| Gene Ontology (6) |
GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 85.5%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 64.1% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 7 in the ORF — 0 in the essential state, 0 growth-defect, 7 non-essential, 0 growth-advantage. Saturation 0.714, mean read count 17.4. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 7 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 7 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 13 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 102.0 ppm · rank 1282/3519 (63.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 193 aa |
|---|---|
| Molecular weight | 20.6 kDa |
| Theoretical pI | 7.03 |
| GRAVY | -0.086 (hydrophilic) |
| Aliphatic index | 109.1 |
| Aromaticity | 0.021 |
| Instability index | 30.5 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Pribosyltran | PF00156.34 | 1.5e-16 | 25–167 | Phosphoribosyl transferase domain |
Experimental structures (Protein Data Bank) 2 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
1w30 |
X-ray diffraction | 1.9 Å | 100% |
5iao |
X-ray diffraction | 2.598 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (2 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
1w30-assembly1_B-2 |
1.00 | 0.97 | 5.4e-36 sig | 1w30-assembly1_B-2 PyrR of Mycobacterium Tuberculosis as a potential drug target |
1w30-assembly1_A-2 |
1.00 | 0.98 | 5.2e-35 sig | 1w30-assembly1_A-2 PyrR of Mycobacterium Tuberculosis as a potential drug target |
5iao-assembly1_F |
1.00 | 0.98 | 1.1e-33 sig | 5iao-assembly1_F Structure and mapping of spontaneous mutational sites of PyrR from Mycobacterium tuberculosis |
4p81-assembly1_D |
1.00 | 0.91 | 2.0e-21 sig | 4p81-assembly1_D Structure of ancestral PyrR protein (AncORANGEPyrR) |
4p84-assembly1_A |
1.00 | 0.87 | 2.2e-22 sig | 4p84-assembly1_A Structure of engineered PyrR protein (VIOLET PyrR) |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 7
| Upstream (5' on genome) | Rv1378c (- strand, -2 bp gap) |
|---|---|
| Downstream (3' on genome) | pyrB (+ strand, -4 bp gap) |
| Predicted operon |
pyrR · pyrB · pyrC · Rv1382 · carA · carB · pyrF
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE) transcription factor
| Regulon | this transcription factor regulates 1 target gene(s) |
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: pyrB (aspartate carbamoyltransferase), high confidence from genomic context alone (score 997 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1380 pyrB exp |
aspartate carbamoyltransferase | 998 | 997 ctx | neighborhood:882 cooccurence:727 coexpression:860 experimental:444 textmining:436 |
Rv1385 pyrF exp |
orotidine 5'-phosphate decarboxylase | 997 | 997 ctx | neighborhood:881 coexpression:776 database:900 |
Rv1381 pyrC exp |
dihydroorotase | 996 | 995 ctx | neighborhood:882 cooccurence:551 coexpression:852 experimental:444 |
Rv1384 carB |
carbamoyl-phosphate synthase large subunit | 982 | 976 ctx | neighborhood:882 coexpression:809 |
Rv1383 carA |
carbamoyl-phosphate synthase small subunit | 972 | 968 ctx | neighborhood:882 coexpression:736 |
Rv1382 hyp |
hypothetical protein | 964 | 960 ctx | neighborhood:882 coexpression:676 |
Rv2883c pyrH exp |
uridylate kinase | 935 | 916 | database:900 |
Rv3307 deoD exp |
purine nucleoside phosphorylase | 905 | 902 | database:900 |
Rv3314c deoA exp |
thymidine phosphorylase | 913 | 901 | database:900 |
Rv3309c upp exp |
uracil phosphoribosyltransferase | 989 | 900 | database:900 textmining:895 |
Rv0382c pyrE |
orotate phosphoribosyltransferase | 819 | 713 | coexpression:697 |
Rv0383c ttfA hyp |
hypothetical protein | 750 | 712 | coexpression:696 |
Rv2139 pyrD |
dihydroorotate dehydrogenase | 818 | 704 | coexpression:654 textmining:413 |
Rv1937 |
oxygenase | 688 | 671 | coexpression:647 |
Rv0385 |
monooxygenase | 685 | 665 | coexpression:646 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: bifunctional pyrimidine operon regulatory protein/uracil phosphoribosyltransferase
- MTBC0 PGAP product: bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR
- Pfam (hmmscan --cut_ga): Pribosyltran PF00156.34 (E=1e-16)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215895.1)
- Domains: Pfam-A via hmmscan --cut_ga — Pribosyltran (PF00156.34)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2065 - Curated reference: UniProt P9WHK3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
42 functional partner(s); context anchor
pyrB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001480|Rv1379|pyrR MGAAGDAAIGRESRELMSAADVGRTISRIAHQIIEKTALDDPVGPDAPRVVLLGIPTRGVTLANRLAGNITEYSGIHVGHGALDITLYRDDLMIKPPRPLASTSIPAGGIDDALVILVDDVLYSGRSVRSALDALRDVGRPRAVQLAVLVDRGHRELPLRADYVGKNVPTSRSESVHVRLREHDGRDGVVISR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for pyrR? Email the maintainer — the message is pre-filled with this gene's details.