pyrR Family assigned · medium auto-curated

H37Rv Rv1379 · MTBC0 mtbc0_001480 · 193 aa · 1561998–1562579 (+) · RefSeq NP_215895.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)bifunctional pyrimidine operon regulatory protein/uracil phosphoribosyltransferase
MTBC0 PGAP re-annotationbifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR
Revised (this work)Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR. Pfam: Pribosyltran (PF00156.34).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHK3 SwissProt · reviewed · Evidence at protein level
UniProt nameBifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase
EC (curated) EC 2.4.2.9
Curated functionRegulates the transcription of the pyrimidine nucleotide (pyr) operon in response to exogenous pyrimidines..; FUNCTION: Also displays a weak uracil phosphoribosyltransferase activity which is not physiologically significant.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred namepyrR
eggNOG descriptionAlso displays a weak uracil phosphoribosyltransferase activity which is not physiologically significant
Orthologous groupCOG2065
EC number EC 2.4.2.9
KEGG orthology K02825
KEGG pathways map00240, map01100
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PribosyltranPF00156.34 1.5e-1625–167 Phosphoribosyl transferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pyrB (aspartate carbamoyltransferase), high confidence from genomic context alone (score 997 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1380 pyrB aspartate carbamoyltransferase 998 997 ctx neighborhood:882 cooccurence:727 coexpression:860 experimental:444 textmining:436
Rv1385 pyrF orotidine 5'-phosphate decarboxylase 997 997 ctx neighborhood:881 coexpression:776 database:900
Rv1381 pyrC dihydroorotase 996 995 ctx neighborhood:882 cooccurence:551 coexpression:852 experimental:444
Rv1384 carB carbamoyl-phosphate synthase large subunit 982 976 ctx neighborhood:882 coexpression:809
Rv1383 carA carbamoyl-phosphate synthase small subunit 972 968 ctx neighborhood:882 coexpression:736
Rv1382 hyp hypothetical protein 964 960 ctx neighborhood:882 coexpression:676
Rv2883c pyrH uridylate kinase 935 916 database:900
Rv3307 deoD purine nucleoside phosphorylase 905 902 database:900
Rv3314c deoA thymidine phosphorylase 913 901 database:900
Rv3309c upp uracil phosphoribosyltransferase 989 900 database:900 textmining:895
Rv0382c pyrE orotate phosphoribosyltransferase 819 713 coexpression:697
Rv0383c ttfA hyp hypothetical protein 750 712 coexpression:696
Rv2139 pyrD dihydroorotate dehydrogenase 818 704 coexpression:654 textmining:413
Rv1937 oxygenase 688 671 coexpression:647
Rv0385 monooxygenase 685 665 coexpression:646

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: bifunctional pyrimidine operon regulatory protein/uracil phosphoribosyltransferase
  • MTBC0 PGAP product: bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR
  • Pfam (hmmscan --cut_ga): Pribosyltran PF00156.34 (E=1e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215895.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Pribosyltran (PF00156.34)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2065
  • Curated reference: UniProt P9WHK3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 42 functional partner(s); context anchor pyrB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001480|Rv1379|pyrR
MGAAGDAAIGRESRELMSAADVGRTISRIAHQIIEKTALDDPVGPDAPRVVLLGIPTRGVTLANRLAGNITEYSGIHVGHGALDITLYRDDLMIKPPRPLASTSIPAGGIDDALVILVDDVLYSGRSVRSALDALRDVGRPRAVQLAVLVDRGHRELPLRADYVGKNVPTSRSESVHVRLREHDGRDGVVISR