PE20 Family assigned · medium auto-curated
H37Rv Rv1806 · MTBC0 - ·
99 aa · 2048072–2048371 (+) ·
RefSeq YP_177843.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PE family protein PE20 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PE family protein PE20. Pfam: PE (PF00934.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
L7N656
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | PE family protein PE20 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| eggNOG description | PE family |
| Orthologous group | COG0657 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.17 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PE | PF00934.26 | 2.8e-26 | 4–94 | PE family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: PPE31 (Rv1807, (MTV049.29), len: 399 aa. PPE31, Member of the Mycobacterium tuberculosis PPE family of glycine-rich proteins, most similar to Rv178), high confidence from genomic context alone (score 703 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1807 PPE31 |
Rv1807, (MTV049.29), len: 399 aa. PPE31, Member of the Mycobacterium tuberculosis PPE family of glycine-rich proteins, most similar to Rv178 | 847 | 703 ctx | neighborhood:703 textmining:506 |
Rv1805c hyp |
hypothetical protein | 792 | 588 ctx | neighborhood:588 textmining:517 |
Rv1808 PPE32 |
PPE family protein PPE32 | 629 | 366 | textmining:440 |
Rv1809 PPE33 |
PPE family protein PPE33 | 473 | 270 | |
Rv3022A PE29 |
PE family protein PE29 | 572 | 41 | textmining:572 |
Rv2770c PPE44 |
PPE family protein PPE44 | 528 | 41 | textmining:529 |
Rv2081c |
transmembrane protein | 515 | 41 | textmining:515 |
Rv2554c ruvX |
Holliday junction resolvase | 513 | 41 | textmining:513 |
Rv2555c alaS |
alanine--tRNA ligase | 511 | 41 | textmining:511 |
Rv2985 mutT1 |
8-oxo-dGTP diphosphatase | 440 | 41 | textmining:440 |
Rv1374c hyp |
hypothetical protein | 433 | 41 | textmining:433 |
Rv1802 PPE30 |
PPE family protein PPE30 | 410 | 41 | textmining:411 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE family protein PE20
- Pfam (hmmscan --cut_ga): PE PF00934.26 (E=3e-26)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177843.1)
- Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0657 - Curated reference: UniProt L7N656 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
12 functional partner(s); context anchor
PPE31 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1806|PE20 MAFVLVCPDALAIAAGQLRHVGSVIAARNAVAAPATAELAPAAADEVSALTATQFNFHAAMYQAVGAQAIAMNEAFVAMLGASADSYAATEAANIIAVS