Rv1377c Resolved · high auto-curated
H37Rv Rv1377c · MTBC0 mtbc0_001478 ·
212 aa ·
1559923–1560561 MTBC0
(-) ·
RefSeq NP_215893.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transferase |
|---|---|
| MTBC0 PGAP re-annotation | class I SAM-dependent methyltransferase |
| Revised (this work) | Class I SAM-dependent methyltransferase. Pfam: MTS (PF05175.21), Methyltransf_23 (PF13489.13), TehB (PF03848.21), Methyltransf_31 (PF13847.13), Ubie_methyltran (PF01209.25), Methyltransf_25 (PF13649.13), CMAS (PF02353.27), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19), TPMT (PF05724.18). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (1 in a M. tuberculosis context, 1 in other mycobacteria — M. marinum (1)).
| Publication | Date |
|---|---|
| Zn2+-Induced Conformational Change Affects the SAM Binding in a Mycobacterial SAM-Dependent Methyltransferase. doi:10.1021/acsomega.2c04555 | 2022 |
| Mycobacterial MMAR_2193 catalyzes O-methylation of diverse polyketide cores. doi:10.1371/journal.pone.0262241 | 2022 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) antiparallel · 10 % of gene
| Neighbour | Rv1376 (Rv1376, + strand) |
|---|---|
| Overlap | 63 bp, 10 % of this gene's length |
antiparallel overlap: this gene may inherit essentiality/conservation signal from its neighbour through shared TA sites or promoter constraint, without any protein of its own being produced (cf. Rv2438A/nadE) Signals attributed to this gene (Tn-seq essentiality via shared TA sites, conservation via promoter constraint) should be cross-checked against the neighbour before being read as its own. P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
WhiB4 (whiB4).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.91 (95% CI -0.07 to 2.45). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown; probably involved in cellular metabolism |
|---|---|
| Mycobrowser EC |
2.-.-.-
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1412c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_2193
· 75.1% identity |
| M. smegmatis |
MSMEG_3041
· 63.6% identity |
| M. orygis |
RJtmp_001457
· 99.5% identity |
| M. abscessus |
MAB_0867c
· 45.9% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P71805
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Transferase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| eggNOG description | Tellurite resistance protein TehB |
| Orthologous group | COG0500 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.156 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 7 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 62.2%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 5/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 35.7% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 14 in the ORF — 0 in the essential state, 0 growth-defect, 14 non-essential, 0 growth-advantage. Saturation 0.929, mean read count 103.230769231. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 217.0 ppm · rank 808/3519 (77.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 212 aa |
|---|---|
| Molecular weight | 22.8 kDa |
| Theoretical pI | 4.79 |
| GRAVY | -0.332 (hydrophilic) |
| Aliphatic index | 72.7 |
| Aromaticity | 0.08 |
| Instability index | 45.2 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MTS | PF05175.21 | 5.7e-07 | 46–120 | Methyltransferase small domain |
Methyltransf_23 | PF13489.13 | 3.3e-09 | 47–154 | Methyltransferase domain |
TehB | PF03848.21 | 4.5e-07 | 47–149 | Tellurite resistance protein TehB |
Methyltransf_31 | PF13847.13 | 1.1e-15 | 48–151 | Methyltransferase domain |
Ubie_methyltran | PF01209.25 | 2.4e-07 | 48–152 | ubiE/COQ5 methyltransferase family |
Methyltransf_25 | PF13649.13 | 3.2e-22 | 49–142 | Methyltransferase domain |
CMAS | PF02353.27 | 7.0e-08 | 49–152 | Mycolic acid cyclopropane synthetase |
Methyltransf_11 | PF08241.19 | 4.9e-18 | 50–146 | Methyltransferase domain |
Methyltransf_12 | PF08242.19 | 2.6e-15 | 50–145 | Methyltransferase domain |
TPMT | PF05724.18 | 1.5e-08 | 52–189 | Thiopurine S-methyltransferase (TPMT) |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.4
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4nec-assembly2_B |
1.00 | 0.84 | 1.9e-23 sig | 4nec-assembly2_B Conversion of a Disulfide Bond into a Thioacetal Group during Echinomycin Biosynthesis |
4nec-assembly1_A |
1.00 | 0.85 | 8.9e-23 sig | 4nec-assembly1_A Conversion of a Disulfide Bond into a Thioacetal Group during Echinomycin Biosynthesis |
4nec-assembly4_D |
1.00 | 0.84 | 4.3e-23 sig | 4nec-assembly4_D Conversion of a Disulfide Bond into a Thioacetal Group during Echinomycin Biosynthesis |
4nec-assembly3_C |
1.00 | 0.83 | 2.3e-22 sig | 4nec-assembly3_C Conversion of a Disulfide Bond into a Thioacetal Group during Echinomycin Biosynthesis |
7bgg-assembly1_A |
1.00 | 0.83 | 7.7e-19 sig | 7bgg-assembly1_A Crystal structure of the heterocyclic toxin methyltransferase from Mycobacterium tuberculosis |
Foldseek search of the AlphaFold DB model (mean pLDDT 94.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv1376 (+ strand, -63 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1378c (- strand, 10 bp gap) |
| Predicted operon |
Rv1377c · Rv1378c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: pyrR (bifunctional pyrimidine operon regulatory protein/uracil phosphoribosyltransferase), medium confidence from genomic context alone (score 621 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1378c hyp |
hypothetical protein | 819 | 819 ctx | neighborhood:776 |
Rv1379 pyrR |
bifunctional pyrimidine operon regulatory protein/uracil phosphoribosyltransferase | 621 | 621 ctx | neighborhood:617 |
Rv1380 pyrB |
aspartate carbamoyltransferase | 620 | 620 ctx | neighborhood:617 |
Rv1385 pyrF |
orotidine 5'-phosphate decarboxylase | 619 | 619 ctx | neighborhood:614 |
Rv1381 pyrC |
dihydroorotase | 618 | 618 ctx | neighborhood:617 |
Rv1382 hyp |
hypothetical protein | 617 | 617 ctx | neighborhood:617 |
Rv1383 carA |
carbamoyl-phosphate synthase small subunit | 617 | 617 ctx | neighborhood:617 |
Rv1384 carB |
carbamoyl-phosphate synthase large subunit | 614 | 614 ctx | neighborhood:614 |
Rv1367c hyp |
hypothetical protein | 602 | 603 ctx | neighborhood:544 |
Rv2678c hemE |
uroporphyrinogen decarboxylase | 543 | 517 ctx | neighborhood:453 |
Rv2676c hemQ hyp |
hypothetical protein | 467 | 468 ctx | neighborhood:453 |
Rv2677c hemY |
protoporphyrinogen oxidase | 490 | 461 ctx | neighborhood:453 |
Rv0520 |
Possible methyltransferase/methylase (fragment); Rv0520, (MTCY20G10.10), len: 116 aa. Possible fragment of methyltransferase (possibly first | 439 | 434 ctx | cooccurence:419 |
Rv3092c |
integral membrane protein | 870 | 47 | textmining:870 |
Rv0783c emrB |
multidrug resistance protein EmrB | 870 | 42 | textmining:870 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transferase
- MTBC0 PGAP product: class I SAM-dependent methyltransferase
- Pfam (hmmscan --cut_ga): MTS PF05175.21 (E=6e-07), Methyltransf_23 PF13489.13 (E=3e-09), TehB PF03848.21 (E=4e-07), Methyltransf_31 PF13847.13 (E=1e-15), Ubie_methyltran PF01209.25 (E=2e-07), Methyltransf_25 PF13649.13 (E=3e-22), CMAS PF02353.27 (E=7e-08), Methyltransf_11 PF08241.19 (E=5e-18), Methyltransf_12 PF08242.19 (E=3e-15), TPMT PF05724.18 (E=1e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215893.1)
- Domains: Pfam-A via hmmscan --cut_ga — MTS (PF05175.21), Methyltransf_23 (PF13489.13), TehB (PF03848.21), Methyltransf_31 (PF13847.13), Ubie_methyltran (PF01209.25), Methyltransf_25 (PF13649.13), CMAS (PF02353.27), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19), TPMT (PF05724.18)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0500 - Curated reference: UniProt P71805 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.4)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
15 functional partner(s); context anchor
pyrR - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001478|Rv1377c| MPGIDFDALYRGESPGEGLPPITTPPWDTKAPKDNVIGWHTGGWVHGDVLDIGCGLGDNAIYLARNGYQVTGLDISPTALTTAKRRASDAGVDVKFAVGDATKLTGYTGAFDTVIDCGMFHCLDDDGKRSYAASVHRATRPGATLLLSCFSNAMPPDEEWPRSTVSEQTLRDVLGGAGWDIESLEPATVRRELDGTEVEMAFWNVRAQRRGS
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv1377c? Email the maintainer — the message is pre-filled with this gene's details.