Rv1377c Resolved · high auto-curated

H37Rv Rv1377c · MTBC0 mtbc0_001478 · 212 aa · 1559923–1560561 (-) · RefSeq NP_215893.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transferase
MTBC0 PGAP re-annotationclass I SAM-dependent methyltransferase
Revised (this work)Class I SAM-dependent methyltransferase. Pfam: MTS (PF05175.21), Methyltransf_23 (PF13489.13), TehB (PF03848.21), Methyltransf_31 (PF13847.13), Ubie_methyltran (PF01209.25), Methyltransf_25 (PF13649.13), CMAS (PF02353.27), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19), TPMT (PF05724.18).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71805 TrEMBL · unreviewed · Evidence at protein level
UniProt nameTransferase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
eggNOG descriptionTellurite resistance protein TehB
Orthologous groupCOG0500

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.156 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 7 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MTSPF05175.21 5.7e-0746–120 Methyltransferase small domain
Methyltransf_23PF13489.13 3.3e-0947–154 Methyltransferase domain
TehBPF03848.21 4.5e-0747–149 Tellurite resistance protein TehB
Methyltransf_31PF13847.13 1.1e-1548–151 Methyltransferase domain
Ubie_methyltranPF01209.25 2.4e-0748–152 ubiE/COQ5 methyltransferase family
Methyltransf_25PF13649.13 3.2e-2249–142 Methyltransferase domain
CMASPF02353.27 7.0e-0849–152 Mycolic acid cyclopropane synthetase
Methyltransf_11PF08241.19 4.9e-1850–146 Methyltransferase domain
Methyltransf_12PF08242.19 2.6e-1550–145 Methyltransferase domain
TPMTPF05724.18 1.5e-0852–189 Thiopurine S-methyltransferase (TPMT)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pyrR (bifunctional pyrimidine operon regulatory protein/uracil phosphoribosyltransferase), medium confidence from genomic context alone (score 621 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1378c hyp hypothetical protein 819 819 ctx neighborhood:776
Rv1379 pyrR bifunctional pyrimidine operon regulatory protein/uracil phosphoribosyltransferase 621 621 ctx neighborhood:617
Rv1380 pyrB aspartate carbamoyltransferase 620 620 ctx neighborhood:617
Rv1385 pyrF orotidine 5'-phosphate decarboxylase 619 619 ctx neighborhood:614
Rv1381 pyrC dihydroorotase 618 618 ctx neighborhood:617
Rv1382 hyp hypothetical protein 617 617 ctx neighborhood:617
Rv1383 carA carbamoyl-phosphate synthase small subunit 617 617 ctx neighborhood:617
Rv1384 carB carbamoyl-phosphate synthase large subunit 614 614 ctx neighborhood:614
Rv1367c hyp hypothetical protein 602 603 ctx neighborhood:544
Rv2678c hemE uroporphyrinogen decarboxylase 543 517 ctx neighborhood:453
Rv2676c hemQ hyp hypothetical protein 467 468 ctx neighborhood:453
Rv2677c hemY protoporphyrinogen oxidase 490 461 ctx neighborhood:453
Rv0520 Possible methyltransferase/methylase (fragment); Rv0520, (MTCY20G10.10), len: 116 aa. Possible fragment of methyltransferase (possibly first 439 434 ctx cooccurence:419
Rv3092c integral membrane protein 870 47 textmining:870
Rv0783c emrB multidrug resistance protein EmrB 870 42 textmining:870

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transferase
  • MTBC0 PGAP product: class I SAM-dependent methyltransferase
  • Pfam (hmmscan --cut_ga): MTS PF05175.21 (E=6e-07), Methyltransf_23 PF13489.13 (E=3e-09), TehB PF03848.21 (E=4e-07), Methyltransf_31 PF13847.13 (E=1e-15), Ubie_methyltran PF01209.25 (E=2e-07), Methyltransf_25 PF13649.13 (E=3e-22), CMAS PF02353.27 (E=7e-08), Methyltransf_11 PF08241.19 (E=5e-18), Methyltransf_12 PF08242.19 (E=3e-15), TPMT PF05724.18 (E=1e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215893.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MTS (PF05175.21), Methyltransf_23 (PF13489.13), TehB (PF03848.21), Methyltransf_31 (PF13847.13), Ubie_methyltran (PF01209.25), Methyltransf_25 (PF13649.13), CMAS (PF02353.27), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19), TPMT (PF05724.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0500
  • Curated reference: UniProt P71805 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s); context anchor pyrR
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001478|Rv1377c|
MPGIDFDALYRGESPGEGLPPITTPPWDTKAPKDNVIGWHTGGWVHGDVLDIGCGLGDNAIYLARNGYQVTGLDISPTALTTAKRRASDAGVDVKFAVGDATKLTGYTGAFDTVIDCGMFHCLDDDGKRSYAASVHRATRPGATLLLSCFSNAMPPDEEWPRSTVSEQTLRDVLGGAGWDIESLEPATVRRELDGTEVEMAFWNVRAQRRGS