lprF Resolved · high auto-curated

H37Rv Rv1368 · MTBC0 mtbc0_001471 · 261 aa · 1551722–1552507 (+) · RefSeq NP_215884.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LprF
MTBC0 PGAP re-annotationlipoprotein LprF
Revised (this work)Lipoprotein LprF. Pfam: LppX_LprAFG (PF07161.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WK47 SwissProt · reviewed · Evidence at protein level
UniProt namePutative diacylated glycolipid transporter LprF
Curated functionMight be involved in transporting short diacylated glycolipids to the cell outer membrane (By similarity). Overexpression induces expression of sensor protein kdpD gene at low K(+) concentrations (0 and 250 uM, tested in M.smegatis).

UniProt still lists this protein as Putative diacylated glycolipid transporter LprF; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namelprF
eggNOG descriptionLppX_LprAFG lipoprotein
Orthologous group2DQVM
KEGG orthology K14954, K14955
KEGG pathways map05152
Gene Ontology (9) GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.112 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
LppX_LprAFGPF07161.20 1.0e-6857–256 LppX_LprAFG lipoprotein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1371 (membrane protein), high confidence from genomic context alone (score 819 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1371 membrane protein 819 819 ctx cooccurence:752
Rv2608 PPE42 PPE family protein PPE42 717 717 ctx cooccurence:711
Rv2695 hyp hypothetical protein 568 569 ctx cooccurence:566
Rv2939 papA5 phthiocerol/phthiodiolone dimycocerosyl transferase 568 568 ctx cooccurence:562
Rv1546 hyp hypothetical protein 541 542 ctx cooccurence:536
Rv3415c hyp hypothetical protein 539 539 ctx cooccurence:539
Rv0128 transmembrane protein 522 522 ctx cooccurence:519
Rv0755c PPE12 PPE family protein PPE12 517 517 ctx cooccurence:514
Rv3217c integral membrane protein 482 483 ctx cooccurence:478
Rv0355c PPE8 PPE family protein PPE8 481 480 ctx cooccurence:477
Rv3732 hyp hypothetical protein 478 479 ctx cooccurence:471
Rv1917c PPE34 PPE family protein PPE34 473 453 ctx cooccurence:445
Rv1410c aminoglycosides/tetracycline-transport integral membrane protein 482 450 ctx cooccurence:411
Rv3343c PPE54 PPE family protein PPE54 469 449 ctx cooccurence:441
Rv1365c rsfA anti-sigma-F factor antagonist RsfA 446 446 ctx cooccurence:438

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LprF
  • MTBC0 PGAP product: lipoprotein LprF
  • Pfam (hmmscan --cut_ga): LppX_LprAFG PF07161.20 (E=1e-68)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215884.1)
  • Domains: Pfam-A via hmmscan --cut_ga — LppX_LprAFG (PF07161.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DQVM
  • Curated reference: UniProt P9WK47 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 51 functional partner(s); context anchor Rv1371
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001471|Rv1368|lprF
MNGLISQACGSHRPRRPSSLGAVAILIAATLFATVVAGCGKKPTTASSPSPGSPSPEAQQILQDSSKATKGLHSVHVVVTVNNLSTLPFESVDADVTNQPQGNGQAVGNAKVRMKPNTPVVATEFLVTNKTMYTKRGGDYVSVGPAEKIYDPGIILDKDRGLGAVVGQVQNPTIQGRDAIDGLATVKVSGTIDAAVIDPIVPQLGKGGGRLPITLWIVDTNASTPAPAANLVRMVIDKDQGNVDITLSNWGAPVTIPNPAG