Rv1366 Family assigned · medium auto-curated

H37Rv Rv1366 · MTBC0 mtbc0_001468 · 273 aa · 1549092–1549913 MTBC0 (+) · RefSeq NP_215882.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationGTP pyrophosphokinase family protein
Revised (this work)GTP pyrophosphokinase family protein. Pfam: RelA_SpoT (PF04607.24).
Functional category (TubercuList)conserved hypotheticals

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 1 publication

Found under: H37Rv (1).

1 TB publication mentions this gene. 1 publication(s) mention this gene (title/abstract), verified against the text. The atlas states the function; these are the primary sources that discuss it.

PublicationDate
Mutational analysis of the (p)ppGpp synthetase activity of the Rel enzyme of Mycobacterium tuberculosis. doi:10.1007/s00203-014-0996-9 2014

This layer CITES the literature, it does not change the verdict or the function. A gene may be heavily studied (as an antigen, a resistance determinant, a drug target) while its molecular function is settled elsewhere in the fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 4 % of gene

NeighbourRv1366A (Rv1366A, + strand)
Overlap32 bp, 4 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1401 · 100.0% identity
M. orygis RJtmp_001446 · 100.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WLZ5 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv1366

UniProt still lists this protein as Uncharacterized protein Rv1366; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionRegion found in RelA / SpoT proteins
Orthologous groupCOG2357

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.341 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Mycobacterium

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 3/53 (6%) · mean identity 65.1% · 1/4 closest MTBAP relatives
present in a subset of the genus (3/53 NTM; in 1 of the 4 closest MTBAP relatives) — partial/intermediate conservation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 19 in the ORF — 0 in the essential state, 0 growth-defect, 19 non-essential, 0 growth-advantage. Saturation 0.947, mean read count 113.333333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 7 of 16 independent MS datasets
Integrated abundance9.75 ppm · rank 2694/3519 (23.5th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length273 aa
Molecular weight30.1 kDa
Theoretical pI5.61
GRAVY-0.219 (hydrophilic)
Aliphatic index98.4
Aromaticity0.059
Instability index50.6 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RelA_SpoTPF04607.24 3.2e-0976–173 Region found in RelA / SpoT proteins

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 86.6

PDB hitprobTM-scoreE-valueDescription
5ded-assembly2_C 1.00 0.66 1.1e-06 sig 5ded-assembly2_C Crystal structure of the small alarmone synthethase 1 from Bacillus subtilis bound to its product pppGpp
5dec-assembly1_A 1.00 0.62 8.4e-07 sig 5dec-assembly1_A Crystal structure of the small alarmone synthetase 1 from Bacillus subtilis
7ztb-assembly2_B 1.00 0.49 9.4e-08 sig 7ztb-assembly2_B Structure of the Salmonella tRNA pyrophosphokinase CapRel
5ded-assembly2_E 1.00 0.63 2.2e-06 sig 5ded-assembly2_E Crystal structure of the small alarmone synthethase 1 from Bacillus subtilis bound to its product pppGpp
5ded-assembly1_B 1.00 0.59 1.2e-06 sig 5ded-assembly1_B Crystal structure of the small alarmone synthethase 1 from Bacillus subtilis bound to its product pppGpp

Foldseek search of the AlphaFold DB model (mean pLDDT 86.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)rsfA (- strand, 220 bp gap)
Downstream (3' on genome)Rv1366A (+ strand, -32 bp gap)
Predicted operon Rv1366 · Rv1366A

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv2209 (integral membrane protein), high confidence from genomic context alone (score 760 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1366A hyp hypothetical protein 834 834 ctx neighborhood:834
Rv2209 integral membrane protein 760 760 ctx cooccurence:756
Rv0355c PPE8 PPE family protein PPE8 756 756 ctx cooccurence:749
Rv3350c PPE56 PPE family protein PPE56 753 754 ctx cooccurence:745
Rv3347c PPE55 PPE family protein PPE55 751 751 ctx cooccurence:744
Rv1452c PE_PGRS28 PE-PGRS family protein PE_PGRS28 751 751 ctx cooccurence:749
Rv2490c PE_PGRS43 PE-PGRS family protein PE_PGRS43 748 748 ctx cooccurence:746
Rv0304c PPE5 PPE family protein PPE5 743 744 ctx cooccurence:736
Rv1917c PPE34 PPE family protein PPE34 742 742 ctx cooccurence:735
Rv1004c membrane protein 742 742 ctx cooccurence:737
Rv3343c PPE54 PPE family protein PPE54 740 740 ctx cooccurence:731
Rv2082 hyp hypothetical protein 738 738 ctx cooccurence:727
Rv0872c PE_PGRS15 PE-PGRS family protein PE_PGRS15 726 727 ctx cooccurence:724
Rv1651c PE_PGRS30 PE-PGRS family protein PE_PGRS30 719 720 ctx cooccurence:717
Rv2954c hyp hypothetical protein 718 719 ctx cooccurence:708

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: GTP pyrophosphokinase family protein
  • Pfam (hmmscan --cut_ga): RelA_SpoT PF04607.24 (E=3e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215882.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RelA_SpoT (PF04607.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2357
  • Curated reference: UniProt P9WLZ5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 86.6)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 94 functional partner(s); context anchor Rv2209
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001468|Rv1366|
MVVALVGSAIVDLHSRPPWSNNAVRRLGVALRDGVDPPVDCPSYAEVMLWHADLAAEVQDRIEGRSWSASELLVTSRAKSQDTLLAKLRRRPYLQLNTIQDIAGVRIDADLLLGEQTRLAREIADHFGADQPAIHDLRDHPHAGYRAVHVWLRLPAGRVEIQIRTILQSLWANFYELLADAYGRGIRYDERPEQLAAGVVPAQLQELVGVMQDASADLAMHEAEWQHCAEIEYPGQRAMALGEASKNKATVLATTKFRLERAINEAESAGGGG