Rv1373 Resolved · high auto-curated

H37Rv Rv1373 · MTBC0 mtbc0_001474 · 326 aa · 1555356–1556336 (+) · RefSeq NP_215889.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)glycolipid sulfotransferase
MTBC0 PGAP re-annotationglycolipid sulfotransferase
Revised (this work)Glycolipid sulfotransferase. Pfam: Sulfotransfer_1 (PF00685.34).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGB9 SwissProt · reviewed · Evidence at protein level
UniProt nameGlycolipid sulfotransferase Rv1373
EC (curated) EC 2.8.2.-
Curated functionInvolved in the synthesis of cell wall sulfolipids with activity towards mycobacterial trehalose glycolipids and eukaryotic glycolipids such as glucosylceramide and galactosylceramide (type I and II) but not towards eukaryotic 3'-sulfate galactosylceramide.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
eggNOG descriptionInvolved in sulfation activity towards typical ceramide glycolipids and trehalose glycolipids
Orthologous group28KEA
EC number EC 2.8.2.1
KEGG orthology K01014
KEGG pathways map05204
Gene Ontology (24) GO:0003674, GO:0003824, GO:0006082, GO:0006629, GO:0006790, GO:0008146, GO:0008150, GO:0008152, GO:0008610, GO:0009058, GO:0009987, GO:0016740 +12 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.655 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 6 missense, 0 nonsense, 3 frameshift
Disruption 3 distinct premature-stop/frameshift site(s); most common in 7.67% of strains (11142) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Sulfotransfer_1PF00685.34 2.7e-4630–304 Sulfotransferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1371 (membrane protein), high confidence from genomic context alone (score 895 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1371 membrane protein 925 895 ctx neighborhood:881
Rv1372 pks18 alpha-pyrone synthesis polyketide synthase-like protein 819 806 ctx neighborhood:801
Rv2353c PPE39 PPE family protein PPE39 573 574 ctx cooccurence:523
Rv1369c Probable transposase; Rv1369c, (MTCY02B12.03c), len: 328 aa. Probable transposase subunit for IS6110. Identical to many other M. tuberculosi 546 546 ctx neighborhood:543
Rv1370c Rv1370c, (MTCY02B12.04c), len: 108 aa. Putative transposase for IS6110 (fragment), identical to many other Mycobacterium tuberculosis IS6110 543 543 ctx neighborhood:543
Rv3533c PPE62 PPE family protein PPE62 459 460
Rv2356c PPE40 Rv2356c, (MTCY98.25), len: 615 aa. PPE40, Member of Mycobacterium tuberculosis PPE_family, highly similar to others e.g. Q10778|MTCY48.17|YF 458 459
Rv3558 PPE64 PPE family protein PPE64 444 445
Rv2048c pks12 polyketide synthase 474 442
Rv1918c PPE35 PPE family protein PPE35 418 419
Rv1135c PPE16 PPE family protein PPE16 400 401
Rv2946c pks1 polyketide synthase 424 399
Rv1663 pks17 polyketide synthase 402 380
Rv1554 frdC fumarate reductase membrane anchor subunit 866 44 textmining:866
Rv1553 frdB fumarate reductase iron-sulfur subunit 853 44 textmining:853

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: glycolipid sulfotransferase
  • MTBC0 PGAP product: glycolipid sulfotransferase
  • Pfam (hmmscan --cut_ga): Sulfotransfer_1 PF00685.34 (E=3e-46)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215889.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Sulfotransfer_1 (PF00685.34)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 28KEA
  • Curated reference: UniProt P9WGB9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s); context anchor Rv1371
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001474|Rv1373|
MNSEHPMTDRVVYRSLMADNLRWDALQLRDGDIIISAPSKSGLTWTQRLVSLLVFDGPDLPGPLSTVSPWLDQTIRPIEEVVATLDAQQHRRFIKTHTPLDGLVLDDRVSYICVGRDPRDAAVSMLYQSANMNEDRMRILHEAVVPFHERIAPPFAELGHARSPTEEFRDWMEGPNQPPPGIGFTHLKGIGTLANILHQLGTVWVRRHLPNVALFHYADYQADLAGELLRLARVLGIAATRDRARDLAQYATLDAMRSRASEIAPNTTDGIWHSDERFFRRGGSGDWQQFFTEAEHLRYYHRINQLAPPDLLAWAHEGRRGYDPAN