Rv1373 Resolved · high auto-curated
H37Rv Rv1373 · MTBC0 mtbc0_001474 ·
326 aa · 1555356–1556336 (+) ·
RefSeq NP_215889.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | glycolipid sulfotransferase |
|---|---|
| MTBC0 PGAP re-annotation | glycolipid sulfotransferase |
| Revised (this work) | Glycolipid sulfotransferase. Pfam: Sulfotransfer_1 (PF00685.34). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WGB9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Glycolipid sulfotransferase Rv1373 |
| EC (curated) |
EC 2.8.2.-
|
| Curated function | Involved in the synthesis of cell wall sulfolipids with activity towards mycobacterial trehalose glycolipids and eukaryotic glycolipids such as glucosylceramide and galactosylceramide (type I and II) but not towards eukaryotic 3'-sulfate galactosylceramide. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| eggNOG description | Involved in sulfation activity towards typical ceramide glycolipids and trehalose glycolipids |
| Orthologous group | 28KEA |
| EC number |
EC 2.8.2.1
|
| KEGG orthology |
K01014
|
| KEGG pathways |
map05204
|
| Gene Ontology (24) |
GO:0003674, GO:0003824, GO:0006082, GO:0006629, GO:0006790, GO:0008146, GO:0008150, GO:0008152, GO:0008610, GO:0009058, GO:0009987, GO:0016740 +12 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.655 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 6 missense, 0 nonsense, 3 frameshift |
| Disruption | 3 distinct premature-stop/frameshift site(s); most common in 7.67% of strains (11142) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Sulfotransfer_1 | PF00685.34 | 2.7e-46 | 30–304 | Sulfotransferase domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1371 (membrane protein), high confidence from genomic context alone (score 895 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1371 |
membrane protein | 925 | 895 ctx | neighborhood:881 |
Rv1372 pks18 |
alpha-pyrone synthesis polyketide synthase-like protein | 819 | 806 ctx | neighborhood:801 |
Rv2353c PPE39 |
PPE family protein PPE39 | 573 | 574 ctx | cooccurence:523 |
Rv1369c |
Probable transposase; Rv1369c, (MTCY02B12.03c), len: 328 aa. Probable transposase subunit for IS6110. Identical to many other M. tuberculosi | 546 | 546 ctx | neighborhood:543 |
Rv1370c |
Rv1370c, (MTCY02B12.04c), len: 108 aa. Putative transposase for IS6110 (fragment), identical to many other Mycobacterium tuberculosis IS6110 | 543 | 543 ctx | neighborhood:543 |
Rv3533c PPE62 |
PPE family protein PPE62 | 459 | 460 | |
Rv2356c PPE40 |
Rv2356c, (MTCY98.25), len: 615 aa. PPE40, Member of Mycobacterium tuberculosis PPE_family, highly similar to others e.g. Q10778|MTCY48.17|YF | 458 | 459 | |
Rv3558 PPE64 |
PPE family protein PPE64 | 444 | 445 | |
Rv2048c pks12 |
polyketide synthase | 474 | 442 | |
Rv1918c PPE35 |
PPE family protein PPE35 | 418 | 419 | |
Rv1135c PPE16 |
PPE family protein PPE16 | 400 | 401 | |
Rv2946c pks1 |
polyketide synthase | 424 | 399 | |
Rv1663 pks17 |
polyketide synthase | 402 | 380 | |
Rv1554 frdC |
fumarate reductase membrane anchor subunit | 866 | 44 | textmining:866 |
Rv1553 frdB |
fumarate reductase iron-sulfur subunit | 853 | 44 | textmining:853 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: glycolipid sulfotransferase
- MTBC0 PGAP product: glycolipid sulfotransferase
- Pfam (hmmscan --cut_ga): Sulfotransfer_1 PF00685.34 (E=3e-46)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215889.1)
- Domains: Pfam-A via hmmscan --cut_ga — Sulfotransfer_1 (PF00685.34)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
28KEA - Curated reference: UniProt P9WGB9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
15 functional partner(s); context anchor
Rv1371 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001474|Rv1373| MNSEHPMTDRVVYRSLMADNLRWDALQLRDGDIIISAPSKSGLTWTQRLVSLLVFDGPDLPGPLSTVSPWLDQTIRPIEEVVATLDAQQHRRFIKTHTPLDGLVLDDRVSYICVGRDPRDAAVSMLYQSANMNEDRMRILHEAVVPFHERIAPPFAELGHARSPTEEFRDWMEGPNQPPPGIGFTHLKGIGTLANILHQLGTVWVRRHLPNVALFHYADYQADLAGELLRLARVLGIAATRDRARDLAQYATLDAMRSRASEIAPNTTDGIWHSDERFFRRGGSGDWQQFFTEAEHLRYYHRINQLAPPDLLAWAHEGRRGYDPAN