Rv1734c Family assigned · medium auto-curated
H37Rv Rv1734c · MTBC0 - ·
80 aa · 1960774–1961016 (-) ·
RefSeq NP_216250.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Contains 2-oxoacid_dh (PF00198.29) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WLS7
SwissProt · reviewed
· Evidence at transcript level
|
|---|---|
| UniProt name | Uncharacterized protein Rv1734c |
UniProt still lists this protein as Uncharacterized protein Rv1734c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| eggNOG description | Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex |
| Orthologous group | COG0508 |
| EC number |
EC 2.3.1.12, EC 2.3.1.61
|
| KEGG orthology |
K00627, K00658
|
| KEGG pathways |
map00010, map00020, map00310, map00620, map01100, map01110, map01120, map01130, map01200
|
| KEGG modules |
M00009, M00011, M00032, M00307
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
2-oxoacid_dh | PF00198.29 | 4.0e-09 | 2–72 | 2-oxoacid dehydrogenases acyltransferase (catalytic domain) |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2496c bkdB |
3-methyl-2-oxobutanoate dehydrogenase subunit beta | 984 | 976 | coexpression:670 experimental:773 database:627 textmining:407 |
Rv1248c kgd |
multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase | 972 | 970 | coexpression:669 experimental:770 database:625 |
Rv0843 |
dehydrogenase | 940 | 921 | coexpression:601 experimental:415 database:591 |
Rv2497c bkdA |
3-methyl-2-oxobutanoate dehydrogenase subunit alpha | 930 | 907 | coexpression:598 experimental:415 database:591 |
Rv2713 sthA |
pyridine nucleotide transhydrogenase | 874 | 864 | coexpression:454 experimental:443 database:565 |
Rv0462 lpdC |
dihydrolipoamide dehydrogenase | 873 | 863 | coexpression:451 experimental:443 database:565 |
Rv0794c |
oxidoreductase | 867 | 861 | coexpression:454 experimental:443 database:565 |
Rv2855 mtr |
mycothione reductase | 866 | 860 | coexpression:451 experimental:443 database:565 |
Rv3303c lpdA |
NAD(P)H quinone reductase LpdA | 866 | 860 | coexpression:451 experimental:443 database:565 |
Rv1017c prsA |
ribose-phosphate pyrophosphokinase | 838 | 824 | experimental:434 database:623 |
Rv2241 aceE |
pyruvate dehydrogenase E1 component | 815 | 788 | coexpression:625 experimental:439 |
Rv1826 gcvH |
glycine cleavage system protein H | 766 | 745 | database:629 |
Rv3128c |
Rv3128c, (MTCY164.38c), len: 337 aa. Conserved hypothetical protein, similar to other conserved hypothetical proteins. This ORF corresponds | 734 | 734 | coexpression:734 |
Rv0018c pstP |
phosphoserine/threonine phosphatase PstP | 742 | 731 | database:571 |
Rv0600c |
two component sensor kinase HK1 | 727 | 716 | experimental:401 database:538 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): 2-oxoacid_dh PF00198.29 (E=4e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216250.1)
- Domains: Pfam-A via hmmscan --cut_ga — 2-oxoacid_dh (PF00198.29)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0508 - Curated reference: UniProt P9WLS7 (SwissProt, reviewed; Evidence at transcript level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 114 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1734c| MTNVGDQGVDAVFGVIYPPQVALVSFGKPAQRVCAVDGAIHVMTTVLATLPADHGCSDDHRGALFFLSINELTRCAAVTG