Rv1734c Family assigned · medium auto-curated

H37Rv Rv1734c · MTBC0 - · 80 aa · 1960774–1961016 (-) · RefSeq NP_216250.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains 2-oxoacid_dh (PF00198.29) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WLS7 SwissProt · reviewed · Evidence at transcript level
UniProt nameUncharacterized protein Rv1734c

UniProt still lists this protein as Uncharacterized protein Rv1734c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
eggNOG descriptionDihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
Orthologous groupCOG0508
EC number EC 2.3.1.12, EC 2.3.1.61
KEGG orthology K00627, K00658
KEGG pathways map00010, map00020, map00310, map00620, map01100, map01110, map01120, map01130, map01200
KEGG modules M00009, M00011, M00032, M00307

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
2-oxoacid_dhPF00198.29 4.0e-092–72 2-oxoacid dehydrogenases acyltransferase (catalytic domain)

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv2496c bkdB 3-methyl-2-oxobutanoate dehydrogenase subunit beta 984 976 coexpression:670 experimental:773 database:627 textmining:407
Rv1248c kgd multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase 972 970 coexpression:669 experimental:770 database:625
Rv0843 dehydrogenase 940 921 coexpression:601 experimental:415 database:591
Rv2497c bkdA 3-methyl-2-oxobutanoate dehydrogenase subunit alpha 930 907 coexpression:598 experimental:415 database:591
Rv2713 sthA pyridine nucleotide transhydrogenase 874 864 coexpression:454 experimental:443 database:565
Rv0462 lpdC dihydrolipoamide dehydrogenase 873 863 coexpression:451 experimental:443 database:565
Rv0794c oxidoreductase 867 861 coexpression:454 experimental:443 database:565
Rv2855 mtr mycothione reductase 866 860 coexpression:451 experimental:443 database:565
Rv3303c lpdA NAD(P)H quinone reductase LpdA 866 860 coexpression:451 experimental:443 database:565
Rv1017c prsA ribose-phosphate pyrophosphokinase 838 824 experimental:434 database:623
Rv2241 aceE pyruvate dehydrogenase E1 component 815 788 coexpression:625 experimental:439
Rv1826 gcvH glycine cleavage system protein H 766 745 database:629
Rv3128c Rv3128c, (MTCY164.38c), len: 337 aa. Conserved hypothetical protein, similar to other conserved hypothetical proteins. This ORF corresponds 734 734 coexpression:734
Rv0018c pstP phosphoserine/threonine phosphatase PstP 742 731 database:571
Rv0600c two component sensor kinase HK1 727 716 experimental:401 database:538

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): 2-oxoacid_dh PF00198.29 (E=4e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216250.1)
  • Domains: Pfam-A via hmmscan --cut_ga — 2-oxoacid_dh (PF00198.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0508
  • Curated reference: UniProt P9WLS7 (SwissProt, reviewed; Evidence at transcript level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 114 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1734c|
MTNVGDQGVDAVFGVIYPPQVALVSFGKPAQRVCAVDGAIHVMTTVLATLPADHGCSDDHRGALFFLSINELTRCAAVTG