Rv1333 Family assigned · medium auto-curated

H37Rv Rv1333 · MTBC0 mtbc0_001430 · 344 aa · 1512301–1513335 MTBC0 (+) · RefSeq NP_215849.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hydrolase
MTBC0 PGAP re-annotationP1 family peptidase
Revised (this work)P1 family peptidase. Pfam: Peptidase_S58 (PF03576.20).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 1.24 (95% CI -1.29 to 4.84). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown; probably involved in cellular metabolism

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1368 · 100.0% identity
M. leprae ML1167 · 76.1% identity
M. marinum MMAR_4065 · 74.8% identity
M. smegmatis MSMEG_4908 · 68.7% identity
M. orygis RJtmp_001407 · 100.0% identity
M. abscessus MAB_1477 · 60.9% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WM23 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized aminopeptidase Rv1333
EC (curated) EC 3.4.11.-
Curated functionAminopeptidase.

UniProt still lists this protein as Uncharacterized aminopeptidase Rv1333; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Q Secondary metabolites biosynthesis, transport and catabolism
Preferred namedmpA
eggNOG descriptionpeptidase S58, DmpA
Orthologous groupCOG3191
KEGG orthology K18572
KEGG pathways map00332, map01130

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.232 · purifying
Polymorphic sites (≥ 0.1% of strains) 10 synonymous, 6 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.11% of strains (156) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

M. canettii dN/dS (deep-divergence selection) 0.194 (low power) · 3 consensus substitution(s)
low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 77.3% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 7/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 52.0%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Regions of Difference (lineage deletions)

RDGene overlapDeleted in lineages
RD711 89% L5 (78%)

This locus overlaps a Region of Difference — a large deletion that is absent in the listed lineages (from the consolidated MTBC RD analysis over ~145 000 strains; H37Rv coordinates). The gene-overlap column is the fraction of the gene inside the RD. RD deletions are classic lineage markers (e.g. RD9 absent in the animal / M. africanum lineages); a gene deleted in a whole lineage is dispensable there.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 13 in the ORF — 0 in the essential state, 0 growth-defect, 13 non-essential, 0 growth-advantage. Saturation 0.923, mean read count 122.25. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection (in vivo) -1.810.029 required
fitness in mouse infection (in vivo) -1.660.017 required
fitness in mouse infection (in vivo) -1.340.0048 required

Conditional fitness of transposon-disruption mutants across 3 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 12 of 16 independent MS datasets
Integrated abundance78.3 ppm · rank 1467/3519 (58.3th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length344 aa
Molecular weight34.0 kDa
Theoretical pI4.8
GRAVY0.496 (hydrophobic)
Aliphatic index98.8
Aromaticity0.049
Instability index34.9 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Peptidase_S58PF03576.20 1.3e-652–331 Peptidase family S58

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.0

PDB hitprobTM-scoreE-valueDescription
3tm1-assembly1_A 1.00 0.86 5.3e-42 sig 3tm1-assembly1_A Crystal structure of mature ThnT, a pantetheine hydrolase
4ihe-assembly1_A 1.00 0.86 2.4e-41 sig 4ihe-assembly1_A Crystal Structure of Uncleaved ThnT T282A
4ihd-assembly1_A 1.00 0.87 7.1e-41 sig 4ihd-assembly1_A Crystal Structure of Uncleaved ThnT T282C, derivatized at the active site with EtHg
3s3u-assembly1_A 1.00 0.87 1.1e-40 sig 3s3u-assembly1_A Crystal Structure of Uncleaved ThnT T282C
4ihe-assembly2_B 1.00 0.86 4.5e-40 sig 4ihe-assembly2_B Crystal Structure of Uncleaved ThnT T282A

Foldseek search of the AlphaFold DB model (mean pLDDT 95.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 11

Upstream (5' on genome)Rv1332 (+ strand, 16 bp gap)
Downstream (3' on genome)mec (+ strand, 7 bp gap)
Predicted operon Rv1331 · Rv1332 · Rv1333 · mec · cysO · cysM · Rv1337 · murI · Rv1339 · rphA · Rv1341

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (5 TF) Rv0023 (represses) · trcR (represses) · Rv2011c (represses) · Rv2034 (activates) · Rv3249c (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: clpS (ATP-dependent Clp protease adapter protein ClpS), high confidence from genomic context alone (score 890 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1331 clpS ATP-dependent Clp protease adapter protein ClpS 895 890 ctx neighborhood:861
Rv1334 mec [CysO 887 886 ctx neighborhood:881
Rv1332 transcriptional regulator 891 875 ctx neighborhood:861
Rv1335 cysO sulfur carrier protein CysO 856 856 ctx neighborhood:851
Rv1337 integral membrane protein 874 855 ctx neighborhood:847
Rv1338 murI glutamate racemase 854 854 ctx neighborhood:847
Rv1336 cysM O-phosphoserine sulfhydrylase 854 854 ctx neighborhood:847
Rv1339 hyp hypothetical protein 815 816 ctx neighborhood:813
Rv1340 rphA ribonuclease PH 803 803 ctx neighborhood:797
Rv1330c pncB1 nicotinic acid phosphoribosyltransferase PncB1 764 764 ctx neighborhood:763
Rv1341 rdgB non-canonical purine NTP pyrophosphatase 761 762 ctx neighborhood:758
Rv1329c dinG ATP-dependent helicase DinG 613 612 ctx neighborhood:609
Rv2075c hyp hypothetical protein 585 60 textmining:577
Rv2479c Probable transposase; Rv2479c, (MTV008.35c), len: 328 aa. Probable transposase for IS6110. Identical to many other M. tuberculosis IS6110 tr 439 50 textmining:434
Rv1521 fadD25 fatty-acid--CoA ligase FadD25 513 47 textmining:510

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hydrolase
  • MTBC0 PGAP product: P1 family peptidase
  • Pfam (hmmscan --cut_ga): Peptidase_S58 PF03576.20 (E=1e-65)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215849.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Peptidase_S58 (PF03576.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3191
  • Curated reference: UniProt P9WM23 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.0)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 17 functional partner(s); context anchor clpS
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Regions of Difference: consolidated MTBC RD analysis (H37Rv coordinates); RD framework from Brosch et al. 2002 (doi:10.1073/pnas.052548299) and Gagneux & Small 2007 (doi:10.1016/S1473-3099(07)70108-1)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001430|Rv1333|
MNSITDVGGIRVGHYQRLDPDASLGAGWACGVTVVLPPPGTVGAVDCRGGAPGTRETDLLDPANSVRFVDALLLAGGSAYGLAAADGVMRWLEEHRRGVAMDSGVVPIVPGAVIFDLPVGGWNCRPTADFGYSACAAAGVDVAVGTVGVGVGARAGALKGGVGTASATLQSGVTVGVLAVVNAAGNVVDPATGLPWMADLVGEFALRAPPAEQIAALAQLSSPLGAFNTPFNTTIGVIACDAALSPAACRRIAIAAHDGLARTIRPAHTPLDGDTVFALATGAVAVPPEAGVPAALSPETQLVTAVGAAAADCLARAVLAGVLNAQPVAGIPTYRDMFPGAFGS