Rv1342c Family assigned · low

H37Rv Rv1342c · MTBC0 - · 120 aa · 1508184–1508546 (-) · RefSeq YP_177800.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Polytopic integral membrane protein with 3 predicted transmembrane helices (DeepTMHMM). RefSeq leaves it 'hypothetical protein'. A topological feature consistent with a membrane transporter/permease or membrane-embedded enzyme; the transported substrate and molecular function are undetermined.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WM19 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv1342c

UniProt still lists this protein as Uncharacterized protein Rv1342c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionmembrane
Orthologous group2E65S
Gene Ontology (14) GO:0005575, GO:0005623, GO:0005886, GO:0005887, GO:0008150, GO:0016020, GO:0016021, GO:0031224, GO:0031226, GO:0040007, GO:0044425, GO:0044459 +2 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF3817PF12823.13 2.0e-2228–111 Domain of unknown function (DUF3817)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 86.4 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
6s37-assembly1_A 0.12 0.53 8.8e+00 6s37-assembly1_A Ligand binding domain of the P. putida receptor PcaY_PP in complex with salicylic acid
1ykh-assembly1_B 0.08 0.35 5.2e+00 1ykh-assembly1_B Structure of the mediator MED7/MED21 (Med7/Srb7) subcomplex
8cok-assembly1_A 0.06 0.39 7.9e+00 8cok-assembly1_A Structural analysis of ING3 protein and its binding to histone H3
5bw9-assembly2_g 0.02 0.26 9.8e+00 5bw9-assembly2_g Crystal Structure of Yeast V1-ATPase in the Autoinhibited Form

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lprD (lipoprotein LprD), high confidence from genomic context alone (score 888 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1343c lprD lipoprotein LprD 888 888 ctx neighborhood:882
Rv1345 mbtM long-chain-fatty-acid--ACP ligase MbtM 593 593 ctx neighborhood:574
Rv2199c ctaF cytochrome c oxidase polypeptide 4 590 590 ctx cooccurence:584
Rv1346 mbtN acyl-[acyl-carrier-protein 576 576 ctx neighborhood:562
Rv1344 mbtL acyl carrier protein MbtL 569 568 ctx neighborhood:562
Rv2229c hyp hypothetical protein 490 491 ctx cooccurence:489
Rv1451 ctaB protoheme IX farnesyltransferase 490 472
Rv2195 qcrA ubiquinol-cytochrome C reductase rieske iron-sulfur subunit 467 445 ctx cooccurence:442
Rv0360c hyp hypothetical protein 459 438 ctx cooccurence:438
Rv3207c hyp hypothetical protein 456 435 ctx cooccurence:432
Rv0102 integral membrane protein 432 433 ctx cooccurence:429
Rv2219A membrane protein 427 427 ctx cooccurence:418
Rv0528 transmembrane protein 423 423 ctx cooccurence:423
Rv2194 qcrC ubiquinol-cytochrome C reductase cytochrome subunit C 419 410 ctx cooccurence:400

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • DeepTMHMM: 3 transmembrane helices (type TM)
  • Integral membrane topology (localisation feature, not a function)
  • DeepTMHMM topology prediction (project 'Still unknown gene function', phase8, 2026-06-10). A topological feature, not a demonstrated molecular function.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177800.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF3817 (PF12823.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E65S
  • Curated reference: UniProt P9WM19 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 86.4, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor lprD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1342c|
MTAPETPAAQHAEPAIAVERIRTALLGYRIMAWTTGLWLIALCYEIVVRYVVKVDNPPTWIGVVHGWVYFTYLLLTLNLAVKVRWPLGKTAGVLLAGTIPLLGIVVEHFQTKEIKARFGL