mbtL Resolved · high auto-curated

H37Rv Rv1344 · MTBC0 - · 106 aa · 1508968–1509288 (+) · RefSeq NP_215860.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)acyl carrier protein MbtL
MTBC0 PGAP re-annotation
Revised (this work)Acyl carrier protein MbtL. Pfam: PP-binding (PF00550.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WQF1 SwissProt · reviewed · Evidence at protein level
UniProt nameAcyl carrier protein MbtL
Curated functionAcyl carrier protein involved in the formation of acyl-S-ACP intermediates within the mycobactin biosynthesis process. The aliphatic chains carried by ACP are subsequently transferred on to the mycobactin core by MbtK.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Q Secondary metabolites biosynthesis, transport and catabolism
Preferred namembtL
eggNOG descriptionacyl carrier protein
Orthologous groupCOG0236
KEGG orthology K02078
Gene Ontology (89) GO:0000035, GO:0000036, GO:0003674, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005975, GO:0006082, GO:0006518 +77 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.239 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PP-bindingPF00550.32 2.1e-1333–99 Phosphopantetheine attachment site

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mbtM (long-chain-fatty-acid--ACP ligase MbtM), high confidence from genomic context alone (score 928 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2524c fas fatty acid synthase 987 984 coexpression:646 experimental:895 database:549
Rv1345 mbtM long-chain-fatty-acid--ACP ligase MbtM 964 928 ctx neighborhood:882 textmining:532
Rv1346 mbtN acyl-[acyl-carrier-protein 918 918 ctx neighborhood:882
Rv2244 acpM meromycolate extension acyl carrier protein 908 900 database:900
Rv3147 nuoC NADH-quinone oxidoreductase subunit C 855 850 coexpression:424 experimental:449 database:564
Rv3146 nuoB NADH-quinone oxidoreductase subunit B 850 844 coexpression:402 experimental:449 database:564
Rv3153 nuoI NADH-quinone oxidoreductase subunit I 850 843 experimental:449 database:564
Rv2243 fabD malonyl CoA-acyl carrier protein transacylase 844 837 coexpression:409 experimental:422 database:549
Rv3149 nuoE NADH-quinone oxidoreductase subunit E 834 830 coexpression:407 experimental:449 database:518
Rv0310c hyp hypothetical protein 816 808 experimental:449 database:561
Rv3148 nuoD NADH-quinone oxidoreductase subunit D 790 781 experimental:449 database:564
Rv2383c mbtB phenyloxazoline synthase 868 779 coexpression:674 textmining:431
Rv3145 nuoA NADH-quinone oxidoreductase subunit A 759 759 experimental:449 database:561
Rv3157 nuoM NADH-quinone oxidoreductase subunit M 753 753 experimental:449 database:561
Rv3152 nuoH NADH-quinone oxidoreductase subunit H 748 749 experimental:449 database:561

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): acyl carrier protein MbtL
  • Pfam (hmmscan --cut_ga): PP-binding PF00550.32 (E=2e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215860.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PP-binding (PF00550.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0236
  • Curated reference: UniProt P9WQF1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 157 functional partner(s); context anchor mbtM
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1344|mbtL
MWRYPLSTRLALPNTPGVASFAMTSSPSTVSTTLLSILRDDLNIDLTRVTPDARLVDDVGLDSVAFAVGMVAIEERLGVALSEEELLTCDTVGELEAAIAAKYRDE