Rv1352 Family assigned · medium auto-curated

H37Rv Rv1352 · MTBC0 mtbc0_001452 · 123 aa · 1529465–1529836 (+) · RefSeq NP_215868.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Contains Rv1352 (PF27111.1) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WM15 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv1352

UniProt still lists this protein as Uncharacterized protein Rv1352; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2AV6T
Gene Ontology (2) GO:0005575, GO:0005576

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Rv1352PF27111.1 3.7e-2735–120 Rv1352-like extracellular domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fabG2 (3-oxoacyl-ACP reductase FabG), medium confidence from genomic context alone (score 461 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1351 hyp hypothetical protein 922 462 ctx neighborhood:459 textmining:861
Rv1350 fabG2 3-oxoacyl-ACP reductase FabG 461 461 ctx neighborhood:461
Rv1810 hyp hypothetical protein 808 63 textmining:804
Rv2290 lppO lipoprotein LppO 634 55 textmining:629
Rv1789 PPE26 PPE family protein PPE26 443 52 textmining:437
Rv0431 tuberculin-like peptide 657 50 textmining:654
Rv3705c hyp hypothetical protein 808 47 textmining:807
Rv1341 rdgB non-canonical purine NTP pyrophosphatase 632 47 textmining:630
Rv1968 mce3C Mce family protein Mce3C 550 47 textmining:548
Rv1970 lprM Mce family lipoprotein LprM 519 47 textmining:516
Rv1808 PPE32 PPE family protein PPE32 513 47 textmining:510
Rv1594 nadA quinolinate synthetase A 426 47 textmining:423
Rv1800 PPE28 PPE family protein PPE28 413 47 textmining:410
Rv1151c cobB NAD-dependent protein deacylase 435 46 textmining:433
Rv1862 adhA alcohol dehydrogenase A 657 45 textmining:656

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Pfam (hmmscan --cut_ga): Rv1352 PF27111.1 (E=4e-27)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215868.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rv1352 (PF27111.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AV6T
  • Curated reference: UniProt P9WM15 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 32 functional partner(s); context anchor fabG2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001452|Rv1352|
MARTLALRASAGLVAGMAMAAITLAPGARAETGEQFPGDGVFLVGTDIAPGTYRTEGPSNPLILVFGRVSELSTCSWSTHSAPEVSNENIVDTNTSMGPMSVVIPPTVAAFQTHNCKLWMRIS