Rv0863 Still unknown · low auto-curated
H37Rv Rv0863 · MTBC0 mtbc0_000918 ·
66 aa · 965883–966083 (+) ·
RefSeq NP_215378.2
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6XWF9
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein |
UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2C7NN |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: qcrA (ubiquinol-cytochrome C reductase rieske iron-sulfur subunit), high confidence from genomic context alone (score 924 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2876 |
transmembrane protein | 991 | 991 | experimental:987 |
Rv3043c ctaD |
cytochrome C oxidase cytochrome 1 | 987 | 987 | experimental:987 |
Rv2196 qcrB |
ubiquinol-cytochrome C reductase cytochrome subunit B | 987 | 987 | experimental:987 |
Rv2199c ctaF |
cytochrome c oxidase polypeptide 4 | 987 | 987 | experimental:987 |
Rv2193 ctaE |
cytochrome C oxidase subunit III | 987 | 987 | experimental:987 |
Rv2195 qcrA |
ubiquinol-cytochrome C reductase rieske iron-sulfur subunit | 923 | 924 ctx | cooccurence:512 experimental:848 |
Rv0865 mog |
molybdopterin biosynthesis protein | 879 | 879 ctx | neighborhood:876 |
Rv0866 moaE2 |
molybdopterin synthase catalytic subunit 2 | 877 | 877 ctx | neighborhood:876 |
Rv2194 qcrC |
ubiquinol-cytochrome C reductase cytochrome subunit C | 867 | 868 | experimental:848 |
Rv2200c ctaC |
cytochrome C oxidase subunit II | 850 | 850 | experimental:848 |
Rv0864 moaC2 |
cyclic pyranopterin monophosphate synthase accessory protein | 816 | 816 ctx | neighborhood:808 |
Rv0862c hyp |
hypothetical protein | 792 | 792 ctx | neighborhood:792 |
Rv2446c |
integral membrane protein | 775 | 775 ctx | cooccurence:774 |
Rv3311 hyp |
hypothetical protein | 771 | 771 ctx | cooccurence:770 |
Rv3205c hyp |
hypothetical protein | 770 | 770 ctx | cooccurence:769 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: hypothetical protein
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215378.2)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2C7NN - Curated reference: UniProt I6XWF9 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 40.3, very low)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
96 functional partner(s); context anchor
qcrA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000918|Rv0863| MADIAEGKARKTRYVDHGWPTTDPDDHAVSELVTDRTGALSPFGELTFPVPSDDLPYIHPVTVINR