Rv0863 Still unknown · low auto-curated

H37Rv Rv0863 · MTBC0 mtbc0_000918 · 66 aa · 965883–966083 (+) · RefSeq NP_215378.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XWF9 TrEMBL · unreviewed · Evidence at protein level
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2C7NN

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: qcrA (ubiquinol-cytochrome C reductase rieske iron-sulfur subunit), high confidence from genomic context alone (score 924 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2876 transmembrane protein 991 991 experimental:987
Rv3043c ctaD cytochrome C oxidase cytochrome 1 987 987 experimental:987
Rv2196 qcrB ubiquinol-cytochrome C reductase cytochrome subunit B 987 987 experimental:987
Rv2199c ctaF cytochrome c oxidase polypeptide 4 987 987 experimental:987
Rv2193 ctaE cytochrome C oxidase subunit III 987 987 experimental:987
Rv2195 qcrA ubiquinol-cytochrome C reductase rieske iron-sulfur subunit 923 924 ctx cooccurence:512 experimental:848
Rv0865 mog molybdopterin biosynthesis protein 879 879 ctx neighborhood:876
Rv0866 moaE2 molybdopterin synthase catalytic subunit 2 877 877 ctx neighborhood:876
Rv2194 qcrC ubiquinol-cytochrome C reductase cytochrome subunit C 867 868 experimental:848
Rv2200c ctaC cytochrome C oxidase subunit II 850 850 experimental:848
Rv0864 moaC2 cyclic pyranopterin monophosphate synthase accessory protein 816 816 ctx neighborhood:808
Rv0862c hyp hypothetical protein 792 792 ctx neighborhood:792
Rv2446c integral membrane protein 775 775 ctx cooccurence:774
Rv3311 hyp hypothetical protein 771 771 ctx cooccurence:770
Rv3205c hyp hypothetical protein 770 770 ctx cooccurence:769

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215378.2)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2C7NN
  • Curated reference: UniProt I6XWF9 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 40.3, very low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 96 functional partner(s); context anchor qcrA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000918|Rv0863|
MADIAEGKARKTRYVDHGWPTTDPDDHAVSELVTDRTGALSPFGELTFPVPSDDLPYIHPVTVINR