mbtK Resolved · high auto-curated

H37Rv Rv1347c · MTBC0 mtbc0_001444 · 210 aa · 1522675–1523307 (-) · RefSeq NP_215863.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lysine N-acetyltransferase MbtK
MTBC0 PGAP re-annotationlysine N-acyltransferase MbtK
Revised (this work)Lysine N-acyltransferase MbtK. Pfam: Acetyltransf_8 (PF13523.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WK15 SwissProt · reviewed · Evidence at protein level
UniProt nameLysine N-acyltransferase MbtK
EC (curated) EC 2.3.1.-
Curated functionAcyltransferase required for the direct transfer of medium- to long-chain fatty acyl moieties from a carrier protein (MbtL) on to the epsilon-amino group of lysine residue in the mycobactin core.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namembtK
eggNOG descriptionCOG1670 Acetyltransferases, including N-acetylases of ribosomal proteins
Orthologous groupCOG1670
KEGG orthology K21992
Gene Ontology (42) GO:0003674, GO:0003824, GO:0006518, GO:0006725, GO:0006807, GO:0008150, GO:0008152, GO:0009058, GO:0009237, GO:0009712, GO:0009987, GO:0016289 +30 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.325 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Acetyltransf_8PF13523.13 1.1e-4551–192 Acetyltransferase (GNAT) domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mbtG (L-lysine N6-monooxygenase), high confidence from genomic context alone (score 794 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3402c hyp hypothetical protein 863 816 coexpression:810
Rv2378c mbtG L-lysine N6-monooxygenase 921 794 ctx cooccurence:410 coexpression:583 textmining:635
Rv0923c hyp hypothetical protein 575 575 ctx cooccurence:575
Rv2925c rnc ribonuclease III 541 541 coexpression:539
Rv1348 irtA iron ABC transporter ATP-binding protein/permease IrtA 813 504 textmining:639
Rv1349 irtB iron ABC transporter ATP-binding protein/permease IrtB 809 492 textmining:640
Rv3073c hyp hypothetical protein 462 463 ctx neighborhood:461
Rv0585c integral membrane protein 425 425
Rv2380c mbtE peptide synthetase 598 424
Rv0779c transmembrane protein 407 408 ctx cooccurence:406
Rv2379c mbtF peptide synthetase 704 395 textmining:531
Rv2386c mbtI salicylate synthase 590 353
Rv2383c mbtB phenyloxazoline synthase 679 310 textmining:555
Rv1346 mbtN acyl-[acyl-carrier-protein 779 298 textmining:699
Rv2382c mbtC polyketide synthetase 714 265 textmining:627

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lysine N-acetyltransferase MbtK
  • MTBC0 PGAP product: lysine N-acyltransferase MbtK
  • Pfam (hmmscan --cut_ga): Acetyltransf_8 PF13523.13 (E=1e-45)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215863.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Acetyltransf_8 (PF13523.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1670
  • Curated reference: UniProt P9WK15 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor mbtG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001444|Rv1347c|mbtK
MTKPTSAGQADDALVRLARERFDLPDQVRRLARPPVPSLEPPYGLRVAQLTDAEMLAEWMNRPHLAAAWEYDWPASRWRQHLNAQLEGTYSLPLIGSWHGTDGGYLELYWAAKDLISHYYDADPYDLGLHAAIADLSKVNRGFGPLLLPRIVASVFANEPRCRRIMFDPDHRNTATRRLCEWAGCKFLGEHDTTNRRMALYALEAPTTAA