mbtN Resolved · high auto-curated
H37Rv Rv1346 · MTBC0 mtbc0_001443 ·
386 aa · 1521548–1522708 (+) ·
RefSeq NP_215862.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | acyl-[acyl-carrier-protein |
|---|---|
| MTBC0 PGAP re-annotation | acyl-ACP dehydrogenase MbtN |
| Revised (this work) | Acyl-ACP dehydrogenase MbtN. Pfam: Acyl-CoA_dh_M (PF02770.25), Acyl-CoA_dh_1 (PF00441.30). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WQF9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Acyl-[acyl-carrier-protein] dehydrogenase MbtN |
| EC (curated) |
EC 1.3.99.-
|
| Curated function | Catalyzes the dehydrogenation at the alpha-beta position of ACP-bound acyl chains. This results in the introduction of a double bond in the lipidic chain, which is further transferred to the epsilon-amino group of lysine residue in the mycobactin core by MbtK. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| Preferred name | mbtN |
| eggNOG description | oxidoreductase activity, acting on the CH-CH group of donors |
| Orthologous group | COG1960 |
| KEGG orthology |
K00257
|
| Gene Ontology (37) |
GO:0003674, GO:0003824, GO:0006518, GO:0006725, GO:0006807, GO:0008150, GO:0008152, GO:0009058, GO:0009237, GO:0009712, GO:0009987, GO:0016491 +25 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.172 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Acyl-CoA_dh_M | PF02770.25 | 8.1e-18 | 117–211 | Acyl-CoA dehydrogenase, middle domain |
Acyl-CoA_dh_1 | PF00441.30 | 3.8e-33 | 224–370 | Acyl-CoA dehydrogenase, C-terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mbtM (long-chain-fatty-acid--ACP ligase MbtM), high confidence from genomic context alone (score 982 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1345 mbtM |
long-chain-fatty-acid--ACP ligase MbtM | 990 | 982 ctx | neighborhood:882 coexpression:817 textmining:484 |
Rv1344 mbtL |
acyl carrier protein MbtL | 918 | 918 ctx | neighborhood:882 |
Rv0860 fadB |
fatty oxidation protein FadB | 802 | 787 | coexpression:646 |
Rv3029c fixA |
electron transfer flavoprotein subunit beta | 779 | 770 | coexpression:405 experimental:418 |
Rv3028c fixB |
electron transfer flavoprotein subunit alpha | 778 | 768 | coexpression:410 experimental:419 |
Rv1933c fadE18 |
acyl-CoA dehydrogenase FadE18 | 661 | 661 ctx | cooccurence:659 |
Rv3139 fadE24 |
acyl-CoA dehydrogenase | 644 | 644 ctx | cooccurence:637 |
Rv0673 echA4 |
enoyl-CoA hydratase EchA4 | 658 | 643 | |
Rv1679 fadE16 |
acyl-CoA dehydrogenase FadE16 | 640 | 641 ctx | cooccurence:639 |
Rv3153 nuoI |
NADH-quinone oxidoreductase subunit I | 651 | 636 | |
Rv3797 fadE35 |
acyl-CoA dehydrogenase FadE35 | 591 | 592 ctx | cooccurence:589 |
Rv2048c pks12 |
polyketide synthase | 617 | 587 | database:459 |
Rv2940c mas |
multifunctional mycocerosic acid synthase | 616 | 585 | database:459 |
Rv3825c pks2 |
phthioceranic/hydroxyphthioceranic acid synthase | 616 | 585 | database:459 |
Rv2933 ppsC |
phthiocerol synthesis polyketide synthase type I PpsC | 616 | 585 | database:459 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: acyl-[acyl-carrier-protein
- MTBC0 PGAP product: acyl-ACP dehydrogenase MbtN
- Pfam (hmmscan --cut_ga): Acyl-CoA_dh_M PF02770.25 (E=8e-18), Acyl-CoA_dh_1 PF00441.30 (E=4e-33)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215862.1)
- Domains: Pfam-A via hmmscan --cut_ga — Acyl-CoA_dh_M (PF02770.25), Acyl-CoA_dh_1 (PF00441.30)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1960 - Curated reference: UniProt P9WQF9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
137 functional partner(s); context anchor
mbtM - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001443|Rv1346|mbtN MTAGSDLDDFRGLLAKAFDERVVAWTAEAEAQERFPRQLIEHLGVCGVFDAKWATDARPDVGKLVELAFALGQLASAGIGVGVSLHDSAIAILRRFGKSDYLRDICDQAIRGAAVLCIGASEESGGSDLQIVETEIRSRDGGFEVRGVKKFVSLSPIADHIMVVARSVDHDPTSRHGNVAVVAVPAAQVSVQTPYRKVGAGPLDTAAVCIDTWVPADALVARAGTGLAAISWGLAHERMSIAGQIAASCQRAIGITLARMMSRRQFGQTLFEHQALRLRMADLQARVDLLRYALHGIAEQGRLELRTAAAVKVTAARLGEEVISECMHIFGGAGYLVDETTLGKWWRDMKLARVGGGTDEVLWELVAAGMTPDHDGYAAVVGASKA