bfrA Resolved · high auto-curated

H37Rv Rv1876 · MTBC0 - · 159 aa · 2125340–2125819 (+) · RefSeq NP_216392.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)bacterioferritin BfrA
MTBC0 PGAP re-annotation
Revised (this work)Bacterioferritin BfrA. Pfam: Ferritin (PF00210.31).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WPQ9 SwissProt · reviewed · Evidence at protein level
UniProt nameBacterioferritin BfrA
EC (curated) EC 1.16.3.1
Curated functionIron-storage protein, whose ferroxidase center binds Fe(2+), oxidizes it using dioxygen to Fe(3+), and participates in the subsequent Fe(3+) oxide mineral core formation within the central cavity of the BFR protein shell.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namebfr
eggNOG descriptionIron-storage protein, whose ferroxidase center binds Fe(2 ) ions, oxidizes them by dioxygen to Fe(3 ), and participates in the subsequent Fe(3 ) oxide mineral core formation within the central cavity of the protein complex
Orthologous groupCOG2193
EC number EC 1.16.3.1
KEGG orthology K03594
KEGG pathways map00860
Gene Ontology (46) GO:0003674, GO:0003824, GO:0004322, GO:0005575, GO:0005576, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006873, GO:0006875 +34 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
FerritinPF00210.31 4.2e-3510–143 Ferritin-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1877 (MFS-type transporter), high confidence from genomic context alone (score 783 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1364c sigma factor regulatory protein 959 944 coexpression:944
Rv0846c mmcO oxidase 919 911 database:900
Rv3841 bfrB bacterioferritin BfrB 995 901 database:900 textmining:954
Rv1485 hemZ ferrochelatase 936 900 database:900
Rv1877 MFS-type transporter 821 783 ctx neighborhood:782
Rv1879 hyp hypothetical protein 738 738 ctx neighborhood:732
Rv1878 glnA3 glutamine synthetase GlnA 771 733 ctx neighborhood:732
Rv1234 transmembrane protein 664 646 coexpression:646
Rv0516c oprA anti-anti-sigma factor 501 470 coexpression:470
Rv1904 hyp hypothetical protein 498 468 coexpression:468
Rv3687c rsfB anti-anti-sigma factor RsfB 499 467 coexpression:467
Rv2638 hyp hypothetical protein 498 466 coexpression:466
Rv1365c rsfA anti-sigma-F factor antagonist RsfA 496 466 coexpression:466
Rv1861 transmembrane protein 423 423 coexpression:406
Rv3287c rsbW anti-sigma factor RsbW 464 409 coexpression:408

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): bacterioferritin BfrA
  • Pfam (hmmscan --cut_ga): Ferritin PF00210.31 (E=4e-35)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216392.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ferritin (PF00210.31)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2193
  • Curated reference: UniProt P9WPQ9 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 35 functional partner(s); context anchor Rv1877
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1876|bfrA
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQDNWGFTELAAHTRAESFDEMRHAEEITDRILLLDGLPNYQRIGSLRIGQTLREQFEADLAIEYDVLNRLKPGIVMCREKQDTTSAVLLEKIVADEEEHIDYLETQLELMDKLGEELYSAQCVSRPPT