bfrA Resolved · high auto-curated
H37Rv Rv1876 · MTBC0 - ·
159 aa · 2125340–2125819 (+) ·
RefSeq NP_216392.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | bacterioferritin BfrA |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Bacterioferritin BfrA. Pfam: Ferritin (PF00210.31). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WPQ9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Bacterioferritin BfrA |
| EC (curated) |
EC 1.16.3.1
|
| Curated function | Iron-storage protein, whose ferroxidase center binds Fe(2+), oxidizes it using dioxygen to Fe(3+), and participates in the subsequent Fe(3+) oxide mineral core formation within the central cavity of the BFR protein shell. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| Preferred name | bfr |
| eggNOG description | Iron-storage protein, whose ferroxidase center binds Fe(2 ) ions, oxidizes them by dioxygen to Fe(3 ), and participates in the subsequent Fe(3 ) oxide mineral core formation within the central cavity of the protein complex |
| Orthologous group | COG2193 |
| EC number |
EC 1.16.3.1
|
| KEGG orthology |
K03594
|
| KEGG pathways |
map00860
|
| Gene Ontology (46) |
GO:0003674, GO:0003824, GO:0004322, GO:0005575, GO:0005576, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006873, GO:0006875 +34 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Ferritin | PF00210.31 | 4.2e-35 | 10–143 | Ferritin-like domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1877 (MFS-type transporter), high confidence from genomic context alone (score 783 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1364c |
sigma factor regulatory protein | 959 | 944 | coexpression:944 |
Rv0846c mmcO |
oxidase | 919 | 911 | database:900 |
Rv3841 bfrB |
bacterioferritin BfrB | 995 | 901 | database:900 textmining:954 |
Rv1485 hemZ |
ferrochelatase | 936 | 900 | database:900 |
Rv1877 |
MFS-type transporter | 821 | 783 ctx | neighborhood:782 |
Rv1879 hyp |
hypothetical protein | 738 | 738 ctx | neighborhood:732 |
Rv1878 glnA3 |
glutamine synthetase GlnA | 771 | 733 ctx | neighborhood:732 |
Rv1234 |
transmembrane protein | 664 | 646 | coexpression:646 |
Rv0516c oprA |
anti-anti-sigma factor | 501 | 470 | coexpression:470 |
Rv1904 hyp |
hypothetical protein | 498 | 468 | coexpression:468 |
Rv3687c rsfB |
anti-anti-sigma factor RsfB | 499 | 467 | coexpression:467 |
Rv2638 hyp |
hypothetical protein | 498 | 466 | coexpression:466 |
Rv1365c rsfA |
anti-sigma-F factor antagonist RsfA | 496 | 466 | coexpression:466 |
Rv1861 |
transmembrane protein | 423 | 423 | coexpression:406 |
Rv3287c rsbW |
anti-sigma factor RsbW | 464 | 409 | coexpression:408 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): bacterioferritin BfrA
- Pfam (hmmscan --cut_ga): Ferritin PF00210.31 (E=4e-35)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216392.1)
- Domains: Pfam-A via hmmscan --cut_ga — Ferritin (PF00210.31)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2193 - Curated reference: UniProt P9WPQ9 (SwissProt, reviewed; Evidence at protein level)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
35 functional partner(s); context anchor
Rv1877 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1876|bfrA MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQDNWGFTELAAHTRAESFDEMRHAEEITDRILLLDGLPNYQRIGSLRIGQTLREQFEADLAIEYDVLNRLKPGIVMCREKQDTTSAVLLEKIVADEEEHIDYLETQLELMDKLGEELYSAQCVSRPPT