rshA Resolved · high auto-curated

H37Rv Rv3221A · MTBC0 - · 101 aa · 3598051–3598356 (-) · RefSeq YP_177945.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)anti-sigma factor RshA
MTBC0 PGAP re-annotation
Revised (this work)Anti-sigma factor RshA. Pfam: zf-HC2 (PF13490.12).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WJ69 SwissProt · reviewed · Evidence at protein level
UniProt nameAnti-sigma factor RshA
Curated functionAn redox-regulated anti-sigma factor for extracytoplasmic function (ECF) sigma factor SigH. ECF sigma factors are held in an inactive form by a cognate anti-sigma factor. RshA and some peptides derived from it inhibit the sigma factor activity of SigH. Probably releases SigH during oxidative stress.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namersrA
eggNOG descriptionanti-sigma factor
Orthologous groupCOG5662
Gene Ontology (40) GO:0000988, GO:0000989, GO:0003674, GO:0005488, GO:0006950, GO:0006979, GO:0008150, GO:0008270, GO:0009266, GO:0009408, GO:0009593, GO:0009628 +28 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
zf-HC2PF13490.12 2.8e-1023–56 Putative zinc-finger

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: sigH (ECF RNA polymerase sigma factor SigH), high confidence from genomic context alone (score 983 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3223c sigH ECF RNA polymerase sigma factor SigH 999 983 ctx neighborhood:882 experimental:800 textmining:953
Rv3222c hyp hypothetical protein 978 979 ctx neighborhood:882 coexpression:826
Rv3221c TB7.3 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit 728 728 ctx neighborhood:720
Rv3224 iron-regulated short-chain dehydrogenase/reductase 720 721 ctx neighborhood:717
Rv3224B Rv3224B, len: 72 aa. Conserved hypothetical protein (possibly gene fragment), similar to C-terminal part of ML0799|AL583919_131 conserved hy 719 720 ctx neighborhood:717
Rv3206c moeB1 adenylyltransferase/sulfurtransferase MoeZ 704 705 coexpression:703
Rv3681c whiB4 transcriptional regulator WhiB4 608 590
Rv3414c sigD ECF RNA polymerase sigma factor SigD 686 557
Rv3780 bpa hyp hypothetical protein 538 539 ctx cooccurence:536
Rv3412 hyp hypothetical protein 524 524 ctx cooccurence:498
Rv0018c pstP phosphoserine/threonine phosphatase PstP 550 516 experimental:500
Rv3220c pdtaS two component sensor kinase 533 515 ctx neighborhood:508
Rv3605c hyp hypothetical protein 506 506 ctx cooccurence:506
Rv0014c pknB serine/threonine-protein kinase PknB 718 505 experimental:500 textmining:454
Rv1221 sigE ECF RNA polymerase sigma factor SigE 701 492 textmining:437

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): anti-sigma factor RshA
  • Pfam (hmmscan --cut_ga): zf-HC2 PF13490.12 (E=3e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177945.1)
  • Domains: Pfam-A via hmmscan --cut_ga — zf-HC2 (PF13490.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5662
  • Curated reference: UniProt P9WJ69 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 47 functional partner(s); context anchor sigH
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3221A|rshA
MSENCGPTDAHADHDDSHGGMGCAEVIAEVWTLLDGECTPETRERLRRHLEACPGCLRHYGLEERIKALIGTKCRGDRAPEGLRERLRLEIRRTTIIRGGP