esxS Resolved · high auto-curated
H37Rv Rv3020c · MTBC0 - ·
97 aa · 3379036–3379329 (-) ·
RefSeq YP_177919.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ESAT-6 like protein EsxS |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | ESAT-6 like protein EsxS. Pfam: WXG100 (PF06013.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
Q6MX18
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | ESAT-6-like protein EsxS |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Preferred name | esxG |
|---|---|
| Orthologous group | 2A0FY |
| Gene Ontology (2) |
GO:0005575, GO:0032991
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
WXG100 | PF06013.19 | 3.1e-07 | 9–87 | Proteins of 100 residues with WXG |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: esxR (ESAT-6 like protein EsxR), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3019c esxR |
ESAT-6 like protein EsxR | 999 | 1000 ctx | neighborhood:682 coexpression:733 experimental:999 textmining:861 |
Rv3017c esxQ |
ESAT-6 like protein EsxQ | 980 | 866 | experimental:822 textmining:859 |
Rv0288 esxH |
ESAT-6-like protein EsxH | 939 | 834 | experimental:822 textmining:650 |
Rv3018c PPE46 |
PPE family protein PPE46 | 611 | 531 | |
Rv3619c esxV |
ESAT-6 like protein EsxV | 422 | 399 | |
Rv3874 esxB |
ESAT-6-like protein EsxB | 810 | 396 | textmining:699 |
Rv1037c esxI |
ESAT-6 like protein EsxI | 495 | 396 | |
Rv2346c esxO |
ESAT-6 like protein EsxO | 419 | 396 | |
Rv3875 esxA |
ESAT-6 protein EsxA | 836 | 394 | textmining:741 |
Rv1038c esxJ |
ESAT-6 like protein EsxJ | 625 | 394 | textmining:407 |
Rv1198 esxL |
ESAT-6 like protein EsxL | 546 | 394 | |
Rv1793 esxN |
ESAT-6 like protein EsxN | 532 | 394 | |
Rv1197 esxK |
ESAT-6 like protein EsxK | 526 | 393 | |
Rv3620c esxW |
ESAT-6 like protein EsxW | 470 | 393 | |
Rv2347c esxP |
ESAT-6 like protein EsxP | 470 | 393 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): ESAT-6 like protein EsxS
- Pfam (hmmscan --cut_ga): WXG100 PF06013.19 (E=3e-07)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177919.1)
- Domains: Pfam-A via hmmscan --cut_ga — WXG100 (PF06013.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2A0FY - Curated reference: UniProt Q6MX18 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
29 functional partner(s); context anchor
esxR - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3020c|esxS MSLLDAHIPQLIASHTAFAAKAGLMRHTIGQAEQQAMSAQAFHQGESAAAFQGAHARFVAAAAKVNTLLDIAQANLGEAAGTYVAADAAAASSYTGF