Rv0779c Still unknown · low auto-curated
H37Rv Rv0779c · MTBC0 mtbc0_000828 ·
206 aa · 877096–877716 (-) ·
RefSeq NP_215293.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transmembrane protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P71833
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible conserved transmembrane protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2DF72 |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.171 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: purC (phosphoribosylaminoimidazole-succinocarboxamide synthase), medium confidence from genomic context alone (score 616 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0780 purC |
phosphoribosylaminoimidazole-succinocarboxamide synthase | 616 | 616 ctx | neighborhood:615 |
Rv0781 ptrBa |
Rv0781, (MTCY369.25), len: 236 aa. Probable ptrBa,first part of protease II, equivalent to N-terminus of NP_302455.1|NC_002677 protease II f | 613 | 613 ctx | neighborhood:611 |
Rv0782 ptrBb |
Rv0782, (MTCY369.26), len: 552 aa. Probable ptrBb,second part of protease II, equivalent to C-terminus of NP_302455.1|NC_002677 protease II | 613 | 612 ctx | neighborhood:611 |
Rv0517 |
acyltransferase | 559 | 559 ctx | cooccurence:557 |
Rv3779 |
transmembrane protein | 513 | 514 ctx | cooccurence:512 |
Rv0875c hyp |
hypothetical protein | 476 | 476 ctx | cooccurence:476 |
Rv0048c |
membrane protein | 467 | 467 ctx | cooccurence:462 |
Rv3166c hyp |
hypothetical protein | 460 | 461 ctx | cooccurence:456 |
Rv1353c |
HTH-type transcriptional regulator | 452 | 452 ctx | cooccurence:450 |
Rv1836c hyp |
hypothetical protein | 439 | 439 ctx | cooccurence:439 |
Rv1365c rsfA |
anti-sigma-F factor antagonist RsfA | 412 | 412 ctx | cooccurence:408 |
Rv3662c hyp |
hypothetical protein | 411 | 412 ctx | cooccurence:408 |
Rv1347c mbtK |
lysine N-acetyltransferase MbtK | 407 | 408 ctx | cooccurence:406 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transmembrane protein
- MTBC0 PGAP product: hypothetical protein
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215293.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2DF72 - Curated reference: UniProt P71833 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
13 functional partner(s); context anchor
purC - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000828|Rv0779c| MRSRFLPYATTPGRLLAQLISDITVAVWTTLWMLVGLAVHDAISIIGEAGRQIEIGSHGIAGNLAAAGQDAQRIPVVGDALSNPITAASQAALDIAGAGHNLDTTAGWLAVVLALAVAATPILAVAMPWLFLRLRFCRRKWTVTTLAATPAGRQLLALRALANRPPGKLAAVSTDPVGAWRREDPATMRALAALELRAAGIPLRGD