Rv0785 Resolved · high auto-curated

H37Rv Rv0785 · MTBC0 mtbc0_000835 · 566 aa · 883766–885466 (+) · RefSeq NP_215299.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)KsdD-like steroid dehydrogenase
MTBC0 PGAP re-annotationFAD-binding dehydrogenase
Revised (this work)FAD-binding dehydrogenase. Pfam: FAD_binding_3 (PF01494.26), FAD_binding_2 (PF00890.31), NAD_binding_8 (PF13450.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71838 SwissProt · reviewed · Evidence at protein level
UniProt nameKsdD-like steroid dehydrogenase Rv0785
EC (curated) EC 1.3.99.-
Curated functionAble to catalyze the elimination of the C-1 and C-2 hydrogen atoms of the A-ring from the polycyclic ring structure of 3-ketosteroids.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDehydrogenase
Orthologous groupCOG3573
KEGG orthology K07077
Gene Ontology (25) GO:0003674, GO:0003824, GO:0005575, GO:0005623, GO:0005886, GO:0006629, GO:0006694, GO:0008150, GO:0008152, GO:0008202, GO:0008610, GO:0009058 +13 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.573 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 5 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 11.99% of strains (17405) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
FAD_binding_3PF01494.26 1.6e-0522–62 FAD binding domain
FAD_binding_2PF00890.31 2.0e-8823–547 FAD binding domain
NAD_binding_8PF13450.13 2.0e-0826–62 NAD(P)-binding Rossmann-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: emrB (multidrug resistance protein EmrB), high confidence from genomic context alone (score 727 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0784 hyp hypothetical protein 863 864 ctx neighborhood:863
Rv0783c emrB multidrug resistance protein EmrB 726 727 ctx neighborhood:723
Rv1769 hyp hypothetical protein 443 444 ctx cooccurence:442

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: KsdD-like steroid dehydrogenase
  • MTBC0 PGAP product: FAD-binding dehydrogenase
  • Pfam (hmmscan --cut_ga): FAD_binding_3 PF01494.26 (E=2e-05), FAD_binding_2 PF00890.31 (E=2e-88), NAD_binding_8 PF13450.13 (E=2e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215299.1)
  • Domains: Pfam-A via hmmscan --cut_ga — FAD_binding_3 (PF01494.26), FAD_binding_2 (PF00890.31), NAD_binding_8 (PF13450.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3573
  • Curated reference: UniProt P71838 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 3 functional partner(s); context anchor emrB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000835|Rv0785|
MALTCTDMSDAVAGSDAEGLTADAIVVGAGLAGLVAACELADRGLRVLILDQENRANVGGQAFWSFGGLFLVNSPEQRRLGIRDSHELALQDWLGTAAFDRPEDYWPEQWAHAYVDFAAGEKRSWLRARGLKIFPLVGWAERGGYDAQGHGNSVPRFHITWGTGPALVDIFVRQLRDRPTVRFAHRHQVDKLIVEGNAVTGVRGTVLEPSDEPRGAPSSRKSVGKFEFRASAVIVASGGIGGNHELVRKNWPRRMGRIPKQLLSGVPAHVDGRMIGIAQKAGAAVINPDRMWHYTEGITNYDPIWPRHGIRIIPGPSSLWLDAAGKRLPVPLFPGFDTLGTLEYITKSGHDYTWFVLNAKIIEKEFALSGQEQNPDLTGRRLGQLLRSRAHAGPPGPVQAFIDRGVDFVHANSLRELVAAMNELPDVVPLDYETVAAAVTARDREVVNKYSKDGQITAIRAARRYRGDRFGRVVAPHRLTDPKAGPLIAVKLHILTRKTLGGIETDLDARVLKADGTPLAGLYAAGEVAGFGGGGVHGYRALEGTFLGGCIFSGRAAGRGAAEDIR