Rv0771 Family assigned · medium auto-curated

H37Rv Rv0771 · MTBC0 mtbc0_000820 · 144 aa · 868564–868998 (+) · RefSeq NP_215285.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)4-carboxymuconolactone decarboxylase
MTBC0 PGAP re-annotationcarboxymuconolactone decarboxylase family protein
Revised (this work)Carboxymuconolactone decarboxylase family protein. Pfam: CMD (PF02627.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6Y4S7 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible 4-carboxymuconolactone decarboxylase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptiondecarboxylase
Orthologous groupCOG0599
EC number EC 4.1.1.44
KEGG orthology K01607
KEGG pathways map00362, map01100, map01120, map01220

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.081 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.46% of strains (665) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CMDPF02627.26 3.7e-0827–100 Carboxymuconolactone decarboxylase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0770 (oxidoreductase), high confidence from genomic context alone (score 991 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0770 oxidoreductase 990 991 ctx neighborhood:882 coexpression:901
Rv0764c cyp51 lanosterol 14-alpha demethylase 947 946 ctx neighborhood:677 cooccurence:433 coexpression:730
Rv0768 aldA aldehyde dehydrogenase AldA 941 939 ctx neighborhood:746 coexpression:736
Rv0762c hyp hypothetical protein 935 936 ctx neighborhood:677 cooccurence:679 coexpression:431
Rv0772 purD phosphoribosylamine--glycine ligase 872 873 ctx neighborhood:872
Rv0765c oxidoreductase 866 862 ctx neighborhood:677 cooccurence:488
Rv0763c ferredoxin 860 861 ctx neighborhood:677 cooccurence:528
Rv0769 oxidoreductase 831 825 ctx neighborhood:773
Rv0311 hyp hypothetical protein 820 820 ctx neighborhood:424 cooccurence:699
Rv0767c HTH-type transcriptional regulator 818 817 ctx neighborhood:451 cooccurence:677
Rv0766c cyp123 cytochrome P450 Cyp123 790 784 ctx neighborhood:677
Rv0761c adhB alcohol dehydrogenase B 645 645 ctx neighborhood:643
Rv0310c hyp hypothetical protein 613 613 ctx cooccurence:592
Rv3519 hyp hypothetical protein 562 562 ctx cooccurence:562
Rv1628c hyp hypothetical protein 508 509 ctx cooccurence:506

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 4-carboxymuconolactone decarboxylase
  • MTBC0 PGAP product: carboxymuconolactone decarboxylase family protein
  • Pfam (hmmscan --cut_ga): CMD PF02627.26 (E=4e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215285.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CMD (PF02627.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0599
  • Curated reference: UniProt I6Y4S7 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor Rv0770
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000820|Rv0771|
MMDELRRTGLDKMNEVYAWDMPDMPGEFFALTVDHLFGRIWTRPGLSMRDRRMAVIAVLTAQGQSDLLEVQVNAVLHNDELTIDELRELAVFITHYVGFPLGSRLNSAIERVAAKRKQAAENGSLPDTKANVAEVLAKESGKSS