Rv0771 Family assigned · medium auto-curated
H37Rv Rv0771 · MTBC0 mtbc0_000820 ·
144 aa · 868564–868998 (+) ·
RefSeq NP_215285.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 4-carboxymuconolactone decarboxylase |
|---|---|
| MTBC0 PGAP re-annotation | carboxymuconolactone decarboxylase family protein |
| Revised (this work) | Carboxymuconolactone decarboxylase family protein. Pfam: CMD (PF02627.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6Y4S7
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible 4-carboxymuconolactone decarboxylase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | decarboxylase |
| Orthologous group | COG0599 |
| EC number |
EC 4.1.1.44
|
| KEGG orthology |
K01607
|
| KEGG pathways |
map00362, map01100, map01120, map01220
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.081 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 1 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.46% of strains (665) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
CMD | PF02627.26 | 3.7e-08 | 27–100 | Carboxymuconolactone decarboxylase family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0770 (oxidoreductase), high confidence from genomic context alone (score 991 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0770 |
oxidoreductase | 990 | 991 ctx | neighborhood:882 coexpression:901 |
Rv0764c cyp51 |
lanosterol 14-alpha demethylase | 947 | 946 ctx | neighborhood:677 cooccurence:433 coexpression:730 |
Rv0768 aldA |
aldehyde dehydrogenase AldA | 941 | 939 ctx | neighborhood:746 coexpression:736 |
Rv0762c hyp |
hypothetical protein | 935 | 936 ctx | neighborhood:677 cooccurence:679 coexpression:431 |
Rv0772 purD |
phosphoribosylamine--glycine ligase | 872 | 873 ctx | neighborhood:872 |
Rv0765c |
oxidoreductase | 866 | 862 ctx | neighborhood:677 cooccurence:488 |
Rv0763c |
ferredoxin | 860 | 861 ctx | neighborhood:677 cooccurence:528 |
Rv0769 |
oxidoreductase | 831 | 825 ctx | neighborhood:773 |
Rv0311 hyp |
hypothetical protein | 820 | 820 ctx | neighborhood:424 cooccurence:699 |
Rv0767c |
HTH-type transcriptional regulator | 818 | 817 ctx | neighborhood:451 cooccurence:677 |
Rv0766c cyp123 |
cytochrome P450 Cyp123 | 790 | 784 ctx | neighborhood:677 |
Rv0761c adhB |
alcohol dehydrogenase B | 645 | 645 ctx | neighborhood:643 |
Rv0310c hyp |
hypothetical protein | 613 | 613 ctx | cooccurence:592 |
Rv3519 hyp |
hypothetical protein | 562 | 562 ctx | cooccurence:562 |
Rv1628c hyp |
hypothetical protein | 508 | 509 ctx | cooccurence:506 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 4-carboxymuconolactone decarboxylase
- MTBC0 PGAP product: carboxymuconolactone decarboxylase family protein
- Pfam (hmmscan --cut_ga): CMD PF02627.26 (E=4e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215285.1)
- Domains: Pfam-A via hmmscan --cut_ga — CMD (PF02627.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0599 - Curated reference: UniProt I6Y4S7 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
34 functional partner(s); context anchor
Rv0770 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000820|Rv0771| MMDELRRTGLDKMNEVYAWDMPDMPGEFFALTVDHLFGRIWTRPGLSMRDRRMAVIAVLTAQGQSDLLEVQVNAVLHNDELTIDELRELAVFITHYVGFPLGSRLNSAIERVAAKRKQAAENGSLPDTKANVAEVLAKESGKSS