Rv0776c Still unknown · low auto-curated

H37Rv Rv0776c · MTBC0 mtbc0_000825 · 259 aa · 873408–874187 (-) · RefSeq NP_215290.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF429 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF429. Function unknown. Foldseek best (non-significant) hit: 4pht-assembly1_X ATPase GspE in complex with the cytoplasmic domain of (prob 0.60, TM 0.40).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6Y4S9 TrEMBL · unreviewed · Predicted
UniProt nameGTP pyrophosphokinase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF429)
Orthologous groupCOG4328

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.507 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF429PF04250.20 1.5e-225–220 Protein of unknown function (DUF429)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 95.7 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
4pht-assembly1_X 0.60 0.40 4.6e-02 4pht-assembly1_X ATPase GspE in complex with the cytoplasmic domain of GspL from the Vibrio vulnificus type II Secretion system
1kcf-assembly1_A 0.35 0.32 4.6e-02 1kcf-assembly1_A Crystal Structure of the Yeast Mitochondrial Holliday Junction Resolvase, Ydc2
9eh2-assembly1_M 0.15 0.26 1.5e-01 9eh2-assembly1_M RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-FACT nucleosome upstream
8oeu-assembly1_S 0.14 0.25 1.0e-01 8oeu-assembly1_S Structure of the mammalian Pol II-SPT6 complex (composite structure, Structure 4)
7p54-assembly1_B 0.08 0.31 1.2e+00 7p54-assembly1_B Cryo-EM structure of human TTYH2 in GDN
2f9t-assembly1_A 0.06 0.21 3.8e-01 2f9t-assembly1_A Structure of the type III CoaA from Pseudomonas aeruginosa
2f9t-assembly1_B 0.06 0.21 5.1e-01 2f9t-assembly1_B Structure of the type III CoaA from Pseudomonas aeruginosa
7ai7-assembly1_B 0.03 0.16 5.4e-01 7ai7-assembly1_B MutS in Intermediate state

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: purB (adenylosuccinate lyase PurB), medium confidence from genomic context alone (score 470 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0777 purB adenylosuccinate lyase PurB 470 470 ctx neighborhood:468
Rv0778 cyp126 cytochrome P450 Cyp126 469 469 ctx neighborhood:468
Rv3700c egtE pyridoxal-phosphate-dependent protein EgtE 406 406 ctx cooccurence:403

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF429 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF429 PF04250.20 (E=1e-22)
  • Foldseek best: 4pht-assembly1_X ATPase GspE in complex with the cytoplasmic domain of GspL from (prob 0.60, E=5e-02, TM=0.40)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215290.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF429 (PF04250.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4328
  • Curated reference: UniProt I6Y4S9 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 95.7, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 3 functional partner(s); context anchor purB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000825|Rv0776c|
MYFVGVDLAWAGRNPTGVAAVDADGCLVGVGAARDDASVLAALRPYVVGDCLVAFDAPLVVANRTGQRPAEAALNRDFRQFEAGAYPANTEKPEFADVPRAARLARQLALDMDPLSSATRRAIEVYPHPATVALFRLPRALKYKAKPGRSVDLLKSELLRLMDGVEGLAQAGVRMQVAGQPDWVSLRRQVTVAQRKSDLRAAEDPIDAVVCAYVALYAQRRPADVTIYGDFTTGYIVTPSLPTDFRTAPDAGRRARARR