Rv0770 Resolved · high auto-curated

H37Rv Rv0770 · MTBC0 mtbc0_000819 · 295 aa · 867680–868567 MTBC0 (+) · RefSeq NP_215284.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand phoP (Rv0757) — requalified: two-component system response regulator PhoP phoR (Rv0758) — requalified: sensory box histidine kinase PhoR phoR Rv0760c (Rv0760c) — family_assigned: ketosteroid isomerase family protein Rv0762c (Rv0762c) — family_assigned: nuclear transport factor 2 family protein Rv0763c (Rv0763c) — requalified: ferredoxin cyp51 (Rv0764c) — requalified: lanosterol 14-alpha demethylase cyp51 Rv0765c (Rv0765c) — family_assigned: SDR family oxidoreductase Rv0765c cyp123 (Rv0766c) — requalified: cytochrome P450 cyp123 Rv0767c (Rv0767c) — family_assigned: TetR/AcrR family transcriptional regulator aldA (Rv0768) — requalified: aldehyde dehydrogenase aldA Rv0769 (Rv0769) — family_assigned: SDR family oxidoreductase Rv0770 (Rv0770) — requalified: NAD(P)-dependent oxidoreductase Rv0770 Rv0771 (Rv0771) — family_assigned: carboxymuconolactone decarboxylase family protein purD (Rv0772) — requalified: phosphoribosylamine--glycine ligase purD Rv0774c (Rv0774c) — requalified: iron-stress inducible esterase Rv0774c Rv0775 (Rv0775) — family_assigned: TetR/AcrR family transcriptional regulator Rv0776c (Rv0776c) — family_assigned: DUF429 domain-containing protein purB (Rv0777) — requalified: adenylosuccinate lyase purB cyp126 (Rv0778) — requalified: cytochrome P450 cyp126 Rv0779c (Rv0779c) — dark: hypothetical protein purC (Rv0780) — requalified: phosphoribosylaminoimidazolesuccinocarboxamide synthase purC 860 kb 864 kb 868 kb 872 kb 876 kb 880 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)oxidoreductase
MTBC0 PGAP re-annotationNAD(P)-dependent oxidoreductase
Revised (this work)NAD(P)-dependent oxidoreductase. Pfam: NAD_binding_2 (PF03446.22), NAD_binding_11 (PF14833.12).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene

NeighbourRv0771 (Rv0771, + strand)
Overlap4 bp, 0 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): Rv0576 (Rv0576).

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index 0.35 (95% CI -0.70 to 2.03). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown; 3-hydroxyisobutyrate dehydrogenase family protein probably involved in cellular metabolism.
Mycobrowser EC 1.1.-.- · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0793 · 99.7% identity
M. marinum MMAR_4926 · 70.1% identity
M. smegmatis MSMEG_5857 · 68.7% identity
M. orygis RJtmp_000816 · 100.0% identity
M. abscessus MAB_1220 · 67.1% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WNY3 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized oxidoreductase Rv0770
EC (curated) EC 1.1.-.-

UniProt still lists this protein as Uncharacterized oxidoreductase Rv0770; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptionDehydrogenase
Orthologous groupCOG2084
EC number EC 1.1.1.31, EC 1.1.1.60
KEGG orthology K00020, K00042
KEGG pathways map00280, map00630, map01100

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.417 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 8 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.266 · 9 consensus substitution(s)
under purifying selection vs M. canettii (deep divergence; dN/dS=0.266) — a real, constrained gene predating the MTBC clonal expansion
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 51/53 (96%) · mean identity 71.1% · 4/4 closest MTBAP relatives
conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 8/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 46.7%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 10 in the ORF — 0 in the essential state, 0 growth-defect, 10 non-essential, 0 growth-advantage. Saturation 0.900, mean read count 92.4444444444. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection (in vivo) -3.420.025 required

Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 13 of 16 independent MS datasets
Integrated abundance34.6 ppm · rank 1995/3519 (43.3th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length295 aa
Molecular weight30.4 kDa
Theoretical pI5.07
GRAVY0.176 (hydrophobic)
Aliphatic index98.1
Aromaticity0.041
Instability index23.0 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NAD_binding_2PF03446.22 2.6e-3810–165 NAD binding domain of 6-phosphogluconate dehydrogenase
NAD_binding_11PF14833.12 1.2e-08170–280 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.9

PDB hitprobTM-scoreE-valueDescription
3qha-assembly1_A 1.00 0.97 4.3e-40 sig 3qha-assembly1_A Crystal structure of a Putative oxidoreductase from Mycobacterium avium 104
6smz-assembly1_B 1.00 0.74 1.1e-21 sig 6smz-assembly1_B Crystal structure of SLA Reductase YihU from E. Coli in complex with NADH
3w6u-assembly1_A 1.00 0.70 9.5e-22 sig 3w6u-assembly1_A Crystal structure of NADP bound L-serine 3-dehydrogenase from Hyperthermophilic Archaeon Pyrobaculum calidifontis
1vpd-assembly1_A 1.00 0.72 3.3e-21 sig 1vpd-assembly1_A X-Ray Crystal Structure of Tartronate Semialdehyde Reductase [Salmonella Typhimurium LT2]
3ws7-assembly1_A 1.00 0.67 1.7e-21 sig 3ws7-assembly1_A The 1.18 A resolution structure of L-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon Pyrobaculum calidifontis

Foldseek search of the AlphaFold DB model (mean pLDDT 94.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 3

Upstream (5' on genome)Rv0769 (+ strand, 97 bp gap)
Downstream (3' on genome)Rv0771 (+ strand, -4 bp gap)
Predicted operon Rv0770 · Rv0771 · purD

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (3 TF) Rv0047c (activates) · Rv1816 (activates) · kstR (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv0771 (4-carboxymuconolactone decarboxylase), high confidence from genomic context alone (score 991 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0771 4-carboxymuconolactone decarboxylase 990 991 ctx neighborhood:882 coexpression:901
Rv0768 aldA aldehyde dehydrogenase AldA 957 956 ctx neighborhood:746 coexpression:832
Rv0762c hyp hypothetical protein 955 956 ctx neighborhood:677 cooccurence:531 coexpression:730
Rv0764c cyp51 lanosterol 14-alpha demethylase 950 950 ctx neighborhood:677 coexpression:801
Rv0765c oxidoreductase 951 949 ctx neighborhood:677 coexpression:802
Rv0766c cyp123 cytochrome P450 Cyp123 895 895 ctx neighborhood:677 coexpression:687
Rv0763c ferredoxin 849 850 ctx neighborhood:677 coexpression:449
Rv0772 purD phosphoribosylamine--glycine ligase 848 848 ctx neighborhood:847
Rv0769 oxidoreductase 783 775 ctx neighborhood:773
Rv0767c HTH-type transcriptional regulator 715 715 ctx neighborhood:505 cooccurence:440
Rv0761c adhB alcohol dehydrogenase B 709 709 ctx neighborhood:643
Rv0311 hyp hypothetical protein 615 616 ctx cooccurence:479
Rv3359 oxidoreductase 491 492
Rv1071c echA9 enoyl-CoA hydratase EchA9 496 477
Rv0760c hyp hypothetical protein 495 477

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: oxidoreductase
  • MTBC0 PGAP product: NAD(P)-dependent oxidoreductase
  • Pfam (hmmscan --cut_ga): NAD_binding_2 PF03446.22 (E=3e-38), NAD_binding_11 PF14833.12 (E=1e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215284.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NAD_binding_2 (PF03446.22), NAD_binding_11 (PF14833.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2084
  • Curated reference: UniProt P9WNY3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.9)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 24 functional partner(s); context anchor Rv0771
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000819|Rv0770|
MTAHPETPRLGYIGLGNQGAPMAKRLLDWPGGLTVFDVRVEAMAPFVEGGATAAASVSDVAEADIISITVFDDAQVSSVITADNGLATHAKPGTIVAIHSTIADTTAVDLAEKLKPQGIHIVDAPVSGGAAAAAKGELAVMVGADDEAFQRIKEPFSRWASLLIHAGEPGAGTRMKLARNMLTFVSYAAAAEAQRLAEACGLDLVALGKVVRHSDSFTGGAGAIMFRNTTAPMEPADPLRPLLEHTRGLGEKDLSLALALGEVVSVDLPLAQLALQRLAAGLGVPHPDTEPAKET