Rv0770 Resolved · high auto-curated
H37Rv Rv0770 · MTBC0 mtbc0_000819 ·
295 aa · 867680–868567 (+) ·
RefSeq NP_215284.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | oxidoreductase |
|---|---|
| MTBC0 PGAP re-annotation | NAD(P)-dependent oxidoreductase |
| Revised (this work) | NAD(P)-dependent oxidoreductase. Pfam: NAD_binding_2 (PF03446.22), NAD_binding_11 (PF14833.12). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WNY3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized oxidoreductase Rv0770 |
| EC (curated) |
EC 1.1.-.-
|
UniProt still lists this protein as Uncharacterized oxidoreductase Rv0770; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| eggNOG description | Dehydrogenase |
| Orthologous group | COG2084 |
| EC number |
EC 1.1.1.31, EC 1.1.1.60
|
| KEGG orthology |
K00020, K00042
|
| KEGG pathways |
map00280, map00630, map01100
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.417 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 8 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
NAD_binding_2 | PF03446.22 | 2.6e-38 | 10–165 | NAD binding domain of 6-phosphogluconate dehydrogenase |
NAD_binding_11 | PF14833.12 | 1.2e-08 | 170–280 | NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0771 (4-carboxymuconolactone decarboxylase), high confidence from genomic context alone (score 991 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0771 |
4-carboxymuconolactone decarboxylase | 990 | 991 ctx | neighborhood:882 coexpression:901 |
Rv0768 aldA |
aldehyde dehydrogenase AldA | 957 | 956 ctx | neighborhood:746 coexpression:832 |
Rv0762c hyp |
hypothetical protein | 955 | 956 ctx | neighborhood:677 cooccurence:531 coexpression:730 |
Rv0764c cyp51 |
lanosterol 14-alpha demethylase | 950 | 950 ctx | neighborhood:677 coexpression:801 |
Rv0765c |
oxidoreductase | 951 | 949 ctx | neighborhood:677 coexpression:802 |
Rv0766c cyp123 |
cytochrome P450 Cyp123 | 895 | 895 ctx | neighborhood:677 coexpression:687 |
Rv0763c |
ferredoxin | 849 | 850 ctx | neighborhood:677 coexpression:449 |
Rv0772 purD |
phosphoribosylamine--glycine ligase | 848 | 848 ctx | neighborhood:847 |
Rv0769 |
oxidoreductase | 783 | 775 ctx | neighborhood:773 |
Rv0767c |
HTH-type transcriptional regulator | 715 | 715 ctx | neighborhood:505 cooccurence:440 |
Rv0761c adhB |
alcohol dehydrogenase B | 709 | 709 ctx | neighborhood:643 |
Rv0311 hyp |
hypothetical protein | 615 | 616 ctx | cooccurence:479 |
Rv3359 |
oxidoreductase | 491 | 492 | |
Rv1071c echA9 |
enoyl-CoA hydratase EchA9 | 496 | 477 | |
Rv0760c hyp |
hypothetical protein | 495 | 477 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: oxidoreductase
- MTBC0 PGAP product: NAD(P)-dependent oxidoreductase
- Pfam (hmmscan --cut_ga): NAD_binding_2 PF03446.22 (E=3e-38), NAD_binding_11 PF14833.12 (E=1e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215284.1)
- Domains: Pfam-A via hmmscan --cut_ga — NAD_binding_2 (PF03446.22), NAD_binding_11 (PF14833.12)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2084 - Curated reference: UniProt P9WNY3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
24 functional partner(s); context anchor
Rv0771 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000819|Rv0770| MTAHPETPRLGYIGLGNQGAPMAKRLLDWPGGLTVFDVRVEAMAPFVEGGATAAASVSDVAEADIISITVFDDAQVSSVITADNGLATHAKPGTIVAIHSTIADTTAVDLAEKLKPQGIHIVDAPVSGGAAAAAKGELAVMVGADDEAFQRIKEPFSRWASLLIHAGEPGAGTRMKLARNMLTFVSYAAAAEAQRLAEACGLDLVALGKVVRHSDSFTGGAGAIMFRNTTAPMEPADPLRPLLEHTRGLGEKDLSLALALGEVVSVDLPLAQLALQRLAAGLGVPHPDTEPAKET