Rv0504c Family assigned · medium auto-curated

H37Rv Rv0504c · MTBC0 mtbc0_000532 · 166 aa · 598143–598643 (-) · RefSeq NP_215018.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationMaoC family dehydratase N-terminal domain-containing protein
Revised (this work)MaoC family dehydratase N-terminal domain-containing protein. Pfam: FAS1_DH_region (PF13452.12).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFK3 SwissProt · reviewed · Evidence at protein level
UniProt nameUPF0336 protein Rv0504c

UniProt still lists this protein as UPF0336 protein Rv0504c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptionBelongs to the UPF0336 family
Orthologous groupCOG2030
Gene Ontology (8) GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.651 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
FAS1_DH_regionPF13452.12 4.6e-2710–140 FAS1-like, dehydratase domain region

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: hadB ((3R)-hydroxyacyl-ACP dehydratase subunit HadB), high confidence from genomic context alone (score 997 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0636 hadB (3R)-hydroxyacyl-ACP dehydratase subunit HadB 999 997 ctx cooccurence:756 experimental:987 textmining:860
Rv0503c cmaA2 cyclopropane mycolic acid synthase 859 859 ctx neighborhood:853
Rv0505c serB1 phosphoserine phosphatase SerB 754 754 ctx neighborhood:747
Rv3339c icd1 isocitrate dehydrogenase 632 632 database:476
Rv2242 hyp hypothetical protein 608 608 ctx cooccurence:605
Rv0125 pepA serine protease PepA 568 569 database:498
Rv0860 fadB fatty oxidation protein FadB 590 565
Rv3671c marP serine protease 562 562 database:498
Rv3274c fadE25 acyl-CoA dehydrogenase 554 554
Rv0983 pepD serine protease PepD 551 552 database:498
Rv1223 htrA serine protease HtrA 551 551 database:498
Rv1043c hyp hypothetical protein 550 550 database:498
Rv2146c transmembrane protein 541 541 ctx cooccurence:534
Rv2243 fabD malonyl CoA-acyl carrier protein transacylase 541 522 ctx cooccurence:502
Rv0231 fadE4 acyl-CoA dehydrogenase FadE4 514 513

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: MaoC family dehydratase N-terminal domain-containing protein
  • Pfam (hmmscan --cut_ga): FAS1_DH_region PF13452.12 (E=5e-27)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215018.1)
  • Domains: Pfam-A via hmmscan --cut_ga — FAS1_DH_region (PF13452.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2030
  • Curated reference: UniProt P9WFK3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 138 functional partner(s); context anchor hadB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000532|Rv0504c|
MTVPEEAQTLIGKHYRAPDHFLVGREKIREFAVAVKDDHPTHYSEPDAAAAGYPALVAPLTFLAIAGRRVQLEIFTKFNIPINIARVFHRDQKFRFHRPILANDKLYFDTYLDSVIESHGTVLAEIRSEVTDAEGKPVVTSVVTMLGEAAHHEADADATVAAIASI