Rv3920c Family assigned · medium auto-curated
H37Rv Rv3920c · MTBC0 mtbc0_004154 ·
187 aa ·
4432585–4433148 MTBC0
(-) ·
RefSeq NP_218437.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | R3H domain-containing nucleic acid-binding protein |
| Revised (this work) | R3H domain-containing nucleic acid-binding protein. Pfam: R3H (PF01424.29). |
| Functional category (TubercuList) | conserved hypotheticals |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) never studied
No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.
A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 28% of residues (metapredict) · mean AlphaFold pLDDT 88.8 |
|---|---|
| Disordered regions | 1 IDR(s), longest 44 aa [0-44] |
carries a substantial disordered region (44/187 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
Phenotype-driven functional lead (hypothesis) priority 5.0
disruption confers tolerance to Ethambutol, Isoniazid; disruption advantageous in vivo (growth-restraining in the host).
| Corroborating evidence | conserved / under constraint intra-MTBC; STRING-coupled to yidC (membrane protein insertase YidC); structural lead available |
|---|
This locus is a "hypothetical" with a conditional Tn-seq phenotype. The statement above is a working hypothesis for its functional context, synthesised from the phenotype pattern and the corroborating layers on this page (conservation, STRING coupling, operon, regulon, localisation, structure) — a prioritised requalification candidate to validate, not an established function.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
WhiB1 (whiB1).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index -1.95 (95% CI -3.22 to -0.28). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3951c
· 99.5% identity |
|---|---|
| M. leprae |
ML2709c
· 73.1% identity |
| M. marinum |
MMAR_5484
· 76.2% identity |
| M. smegmatis |
MSMEG_6941
· 77.8% identity |
| M. orygis |
RJtmp_004035
· 99.5% identity |
| M. abscessus |
MAB_4952c
· 82.6% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O53598
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein similar to jag protein |
UniProt still lists this protein as Conserved protein similar to jag protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | jag |
| eggNOG description | RNA-binding protein |
| Orthologous group | COG1847 |
| KEGG orthology |
K06346
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.296 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 8 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 91.7%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 9/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 68.8% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 4 in the ORF — 0 in the essential state, 0 growth-defect, 4 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 56.75. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Statistically thin call: only 4 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| altered fitness under Ethambutol (drug exposure) | +3.59 | 0.0 | disruption advantageous |
| Mutants exhibiting altered fitness in the absence of gene marP (other) | +2.83 | 0.0 | disruption advantageous |
| altered fitness under Isoniazid (drug exposure) | +2.29 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +2.26 | 0.0052 | disruption advantageous |
| Differential genetic requirements of clinical Mtb strain (ID=621) from East Asian lineage (compared to H37Rv control) (strain background) | +2.22 | 0.046 | required |
| altered fitness under Ethambutol (drug exposure) | +2.03 | 0.0 | disruption advantageous |
| altered fitness under Isoniazid (drug exposure) | +1.99 | 0.0 | disruption advantageous |
| Differential genetic requirements of clinical Mtb strain (ID=641) from Indo-Oceanic lineage (compared to H37Rv control) (strain background) | +1.60 | 0.041 | required |
Conditional fitness of transposon-disruption mutants across 8 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 610.0 ppm · rank 352/3519 (90.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 187 aa |
|---|---|
| Molecular weight | 20.6 kDa |
| Theoretical pI | 4.31 |
| GRAVY | -0.486 (hydrophilic) |
| Aliphatic index | 93.3 |
| Aromaticity | 0.027 |
| Instability index | 52.1 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
R3H | PF01424.29 | 4.1e-18 | 126–185 | R3H domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 88.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3gku-assembly1_A |
1.00 | 0.72 | 4.2e-13 sig | 3gku-assembly1_A Crystal structure of a probable RNA-binding protein from Clostridium symbiosum ATCC 14940 |
3gku-assembly1_B |
1.00 | 0.76 | 1.9e-12 sig | 3gku-assembly1_B Crystal structure of a probable RNA-binding protein from Clostridium symbiosum ATCC 14940 |
2pt7-assembly1_H |
1.00 | 0.58 | 2.4e-06 sig | 2pt7-assembly1_H Crystal structure of Cag VirB11 (HP0525) and an inhibitory protein (HP1451) |
3gku-assembly2_C-2 |
1.00 | 0.78 | 3.1e-04 sig | 3gku-assembly2_C-2 Crystal structure of a probable RNA-binding protein from Clostridium symbiosum ATCC 14940 |
8b2l-assembly1_a1 |
0.95 | 0.35 | 2.4e-03 sig | 8b2l-assembly1_a1 Cryo-EM structure of the plant 80S ribosome |
Foldseek search of the AlphaFold DB model (mean pLDDT 88.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | gid (- strand, 131 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3921c (- strand, 71 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: yidC (membrane protein insertase YidC), high confidence from genomic context alone (score 986 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3921c yidC |
membrane protein insertase YidC | 987 | 986 ctx | neighborhood:792 coexpression:909 |
Rv3923c rnpA |
ribonuclease P protein component | 961 | 960 ctx | neighborhood:792 coexpression:814 |
Rv3922c yidD |
membrane protein insertion efficiency factor | 955 | 955 ctx | neighborhood:792 coexpression:794 |
Rv3919c gid |
16S rRNA (guanine(527)-N(7))-methyltransferase RsmG | 947 | 938 ctx | neighborhood:727 coexpression:783 |
Rv2908c hyp exp |
hypothetical protein | 992 | 931 | experimental:891 textmining:889 |
Rv3917c parB |
chromosome partitioning protein ParB | 842 | 833 ctx | neighborhood:758 |
Rv1297 rho |
transcription termination factor Rho | 817 | 806 | coexpression:805 |
Rv0708 rplP |
50S ribosomal protein L16 | 804 | 804 | coexpression:804 |
Rv1613 trpA |
tryptophan synthase subunit alpha | 804 | 804 | coexpression:804 |
Rv0706 rplV |
50S ribosomal protein L22 | 803 | 803 | coexpression:803 |
Rv0721 rpsE |
30S ribosomal protein S5 | 802 | 802 | coexpression:802 |
Rv0705 rpsS |
30S ribosomal protein S19 | 801 | 801 | coexpression:801 |
Rv0723 rplO |
50S ribosomal protein L15 | 800 | 800 | coexpression:800 |
Rv0710 rpsQ |
30S ribosomal protein S17 | 799 | 799 | coexpression:799 |
Rv0704 rplB |
50S ribosomal protein L2 | 794 | 795 | coexpression:795 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: R3H domain-containing nucleic acid-binding protein
- Pfam (hmmscan --cut_ga): R3H PF01424.29 (E=4e-18)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218437.1)
- Domains: Pfam-A via hmmscan --cut_ga — R3H (PF01424.29)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1847 - Curated reference: UniProt O53598 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 88.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
46 functional partner(s); context anchor
yidC - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_004154|Rv3920c| MADADTTDFDVDAEAPGGGVREDTATDADEADDQEERLVAEGEIAGDYLEELLDVLDFDGDIDLDVEGNRAVVSIDGSDDLNKLVGRGGEVLDALQELTRLAVHQKTGVRSRLMLDIARWRRRRREELAALADEVARRVAETGDREELVPMTPFERKIVHDAVAAVPGVHSESEGVEPERRVVVLRD
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv3920c? Email the maintainer — the message is pre-filled with this gene's details.