Rv3920c Family assigned · medium auto-curated

H37Rv Rv3920c · MTBC0 mtbc0_004154 · 187 aa · 4432585–4433148 (-) · RefSeq NP_218437.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationR3H domain-containing nucleic acid-binding protein
Revised (this work)R3H domain-containing nucleic acid-binding protein. Pfam: R3H (PF01424.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53598 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein similar to jag protein

UniProt still lists this protein as Conserved protein similar to jag protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namejag
eggNOG descriptionRNA-binding protein
Orthologous groupCOG1847
KEGG orthology K06346

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.296 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 8 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
R3HPF01424.29 4.1e-18126–185 R3H domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: yidC (membrane protein insertase YidC), high confidence from genomic context alone (score 986 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3921c yidC membrane protein insertase YidC 987 986 ctx neighborhood:792 coexpression:909
Rv3923c rnpA ribonuclease P protein component 961 960 ctx neighborhood:792 coexpression:814
Rv3922c yidD membrane protein insertion efficiency factor 955 955 ctx neighborhood:792 coexpression:794
Rv3919c gid 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG 947 938 ctx neighborhood:727 coexpression:783
Rv2908c hyp hypothetical protein 992 931 experimental:891 textmining:889
Rv3917c parB chromosome partitioning protein ParB 842 833 ctx neighborhood:758
Rv1297 rho transcription termination factor Rho 817 806 coexpression:805
Rv0708 rplP 50S ribosomal protein L16 804 804 coexpression:804
Rv1613 trpA tryptophan synthase subunit alpha 804 804 coexpression:804
Rv0706 rplV 50S ribosomal protein L22 803 803 coexpression:803
Rv0721 rpsE 30S ribosomal protein S5 802 802 coexpression:802
Rv0705 rpsS 30S ribosomal protein S19 801 801 coexpression:801
Rv0723 rplO 50S ribosomal protein L15 800 800 coexpression:800
Rv0710 rpsQ 30S ribosomal protein S17 799 799 coexpression:799
Rv0704 rplB 50S ribosomal protein L2 794 795 coexpression:795

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: R3H domain-containing nucleic acid-binding protein
  • Pfam (hmmscan --cut_ga): R3H PF01424.29 (E=4e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218437.1)
  • Domains: Pfam-A via hmmscan --cut_ga — R3H (PF01424.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1847
  • Curated reference: UniProt O53598 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 46 functional partner(s); context anchor yidC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004154|Rv3920c|
MADADTTDFDVDAEAPGGGVREDTATDADEADDQEERLVAEGEIAGDYLEELLDVLDFDGDIDLDVEGNRAVVSIDGSDDLNKLVGRGGEVLDALQELTRLAVHQKTGVRSRLMLDIARWRRRRREELAALADEVARRVAETGDREELVPMTPFERKIVHDAVAAVPGVHSESEGVEPERRVVVLRD