cmaA2 Resolved · high auto-curated

H37Rv Rv0503c · MTBC0 mtbc0_000531 · 302 aa · 597212–598120 (-) · RefSeq NP_215017.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cyclopropane mycolic acid synthase
MTBC0 PGAP re-annotationcyclopropane mycolic acid synthase CmaA2
Revised (this work)Cyclopropane mycolic acid synthase CmaA2. Pfam: CMAS (PF02353.27), Methyltransf_23 (PF13489.13), Methyltransf_12 (PF08242.19), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPB5 SwissProt · reviewed · Evidence at protein level
UniProt nameCyclopropane mycolic acid synthase 2
EC (curated) EC 2.1.1.79
Curated functionCatalyzes the formation of trans cyclopropanated ketomycolate or methoxymycolate through the conversion of a double bond to a cyclopropane ring at the proximal position of an oxygenated mycolic acid via the transfer of a methylene group from S-adenosyl-L-methionine. In the absence of MmaA2, CmaA2 has a non-specific cis-cyclopropanating activity and is able to catalyze the conversion of a double bond to a cis cyclopropane ring at the distal position of an alpha mycolic acid. Cyclopropanated mycolic acids are key factors participating in cell envelope permeability, host immunomodulation and pers.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namecmaA2
eggNOG descriptionsynthase
Orthologous groupCOG2230
EC number EC 2.1.1.79
KEGG orthology K00574
Gene Ontology (93) GO:0001666, GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006082, GO:0006629, GO:0006631 +81 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.116 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CMASPF02353.27 1.3e-11713–298 Mycolic acid cyclopropane synthetase
Methyltransf_23PF13489.13 8.1e-0967–195 Methyltransferase domain
Methyltransf_12PF08242.19 4.1e-0777–177 Methyltransferase domain
Methyltransf_25PF13649.13 8.4e-0777–158 Methyltransferase domain
Methyltransf_11PF08241.19 2.0e-0477–177 Methyltransferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: serB1 (phosphoserine phosphatase SerB), high confidence from genomic context alone (score 732 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0504c hyp hypothetical protein 859 859 ctx neighborhood:853
Rv0505c serB1 phosphoserine phosphatase SerB 732 732 ctx neighborhood:731
Rv0449c hyp hypothetical protein 428 401
Rv3800c pks13 polyketide synthase 483 117 textmining:439
Rv1527c pks5 polyketide synthase 420 106
Rv1483 fabG1 3-oxoacyl-ACP reductase FabG 522 80 textmining:502
Rv2246 kasB 3-oxoacyl-ACP synthase 2 481 72 textmining:464
Rv2245 kasA 3-oxoacyl-ACP synthase 1 438 72 textmining:420
Rv3801c fadD32 long-chain-fatty-acid--AMP ligase FadD32 552 60 textmining:543
Rv1484 inhA NADH-dependent enoyl-[ACP 402 52
Rv1407 fmu 16S rRNA m5C967 methyltransferase 445 48 textmining:442
Rv3787c S-adenosyl-L-methionine-dependent methyltransferase 433 41 textmining:433

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: cyclopropane mycolic acid synthase
  • MTBC0 PGAP product: cyclopropane mycolic acid synthase CmaA2
  • Pfam (hmmscan --cut_ga): CMAS PF02353.27 (E=1e-117), Methyltransf_23 PF13489.13 (E=8e-09), Methyltransf_12 PF08242.19 (E=4e-07), Methyltransf_25 PF13649.13 (E=8e-07), Methyltransf_11 PF08241.19 (E=2e-04)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215017.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CMAS (PF02353.27), Methyltransf_23 (PF13489.13), Methyltransf_12 (PF08242.19), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2230
  • Curated reference: UniProt P9WPB5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 12 functional partner(s); context anchor serB1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000531|Rv0503c|cmaA2
MTSQGDTTSGTQLKPPVEAVRSHYDKSNEFFKLWLDPSMTYSCAYFERPDMTLEEAQYAKRKLALDKLNLEPGMTLLDIGCGWGSTMRHAVAEYDVNVIGLTLSENQYAHDKAMFDEVDSPRRKEVRIQGWEEFDEPVDRIVSLGAFEHFADGAGDAGFERYDTFFKKFYNLTPDDGRMLLHTITIPDKEEAQELGLTSPMSLLRFIKFILTEIFPGGRLPRISQVDYYSSNAGWKVERYHRIGANYVPTLNAWADALQAHKDEAIALKGQETYDIYMHYLRGCSDLFRDKYTDVCQFTLVK