Rv0318c Family assigned · medium auto-curated

H37Rv Rv0318c · MTBC0 - · 264 aa · 386305–387099 (-) · RefSeq YP_177716.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)integral membrane protein
MTBC0 PGAP re-annotation
Revised (this work)Integral membrane protein. Pfam: Zip (PF02535.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q6MX47 TrEMBL · unreviewed · Predicted
UniProt nameProbable conserved integral membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
eggNOG descriptiontransporter
Orthologous groupCOG0428
KEGG orthology K07238

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.977 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 5 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.11% of strains (156) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ZipPF02535.29 2.3e-12131–263 ZIP Zinc transporter

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pcp (pyrrolidone-carboxylate peptidase), medium confidence from genomic context alone (score 564 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2874 dipZ integral membrane C-type cytochrome biogenesis protein DipZ 654 641 coexpression:465
Rv0319 pcp pyrrolidone-carboxylate peptidase 563 564 ctx neighborhood:561
Rv1749c integral membrane protein 545 546 ctx cooccurence:544
Rv1348 irtA iron ABC transporter ATP-binding protein/permease IrtA 516 516 coexpression:447
Rv0355c PPE8 PPE family protein PPE8 516 516 ctx cooccurence:513
Rv3846 sodA superoxide dismutase 533 512 coexpression:472
Rv2216 epimerase family protein 507 508 coexpression:467
Rv0320 hyp hypothetical protein 502 502 ctx neighborhood:496
Rv2490c PE_PGRS43 PE-PGRS family protein PE_PGRS43 502 502 ctx cooccurence:502
Rv3347c PPE55 PPE family protein PPE55 493 494 ctx cooccurence:491
Rv1651c PE_PGRS30 PE-PGRS family protein PE_PGRS30 489 489 ctx cooccurence:489
Rv3350c PPE56 PPE family protein PPE56 488 488 ctx cooccurence:485
Rv2267c stf3 hyp hypothetical protein 511 486
Rv1753c PPE24 PPE family protein PPE24 468 468 ctx cooccurence:465
Rv1917c PPE34 PPE family protein PPE34 467 468 ctx cooccurence:466

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): integral membrane protein
  • Pfam (hmmscan --cut_ga): Zip PF02535.29 (E=2e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177716.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Zip (PF02535.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0428
  • Curated reference: UniProt Q6MX47 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 53 functional partner(s); context anchor pcp
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0318c|
MSLAVTMFKRARAEIFDRNREVGISNVTTAASLVTFPVLAGILGGVVPSVRTPSAAMVSGVQHFAAGIVMAAVAGEVLPDLRSRGPLWLIVVGFSAGVAVLVALRRFDGHGEHQDGDDVGELPVGFLTVVAVDLFIDGLLVATGATVSSRTAIIITIALTVEVLFLGLAVALRLAGSGMPRIRAAATTSALSLVIAVGGVSGAVALGRAGNTVLTLVLAFAAGALLWLVVEELLVEAHETPERPWMAVMFFAGFLILYGLGVME