pcp Resolved · high auto-curated

H37Rv Rv0319 · MTBC0 mtbc0_000340 · 222 aa · 390471–391139 (+) · RefSeq NP_214833.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)pyrrolidone-carboxylate peptidase
MTBC0 PGAP re-annotationpyroglutamyl-peptidase I
Revised (this work)Pyroglutamyl-peptidase I. Pfam: Peptidase_C15 (PF01470.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIJ5 SwissProt · reviewed · Evidence at protein level
UniProt namePyrrolidone-carboxylate peptidase
EC (curated) EC 3.4.19.3
Curated functionRemoves 5-oxoproline from various penultimate amino acid residues except L-proline.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namepcp
eggNOG descriptionRemoves 5-oxoproline from various penultimate amino acid residues except L-proline
Orthologous groupCOG2039
EC number EC 3.4.19.3
KEGG orthology K01304
Gene Ontology (9) GO:0006508, GO:0006807, GO:0008150, GO:0008152, GO:0019538, GO:0043170, GO:0044238, GO:0071704, GO:1901564

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.776 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Peptidase_C15PF01470.23 2.7e-953–208 Pyroglutamyl peptidase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0318c (integral membrane protein), medium confidence from genomic context alone (score 564 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0320 hyp hypothetical protein 757 756 ctx neighborhood:754
Rv0318c integral membrane protein 563 564 ctx neighborhood:561
Rv0321 dcd deoxycytidine triphosphate deaminase 560 560 ctx neighborhood:560
Rv0263c hyp hypothetical protein 482 460
Rv0264c hyp hypothetical protein 467 448
Rv3468c dTDP-glucose 4,6-dehydratase 570 47 textmining:568

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: pyrrolidone-carboxylate peptidase
  • MTBC0 PGAP product: pyroglutamyl-peptidase I
  • Pfam (hmmscan --cut_ga): Peptidase_C15 PF01470.23 (E=3e-95)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214833.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Peptidase_C15 (PF01470.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2039
  • Curated reference: UniProt P9WIJ5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 6 functional partner(s); context anchor Rv0318c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000340|Rv0319|pcp
MSKVLVTGFGPYGVTPVNPAQLTAEELDGRTIAGATVISRIVPNTFFESIAAAQQAIAEIEPALVIMLGEYPGRSMITVERLAQNVNDCGRYGLADCAGRVLVGEPTDPAGPVAYHATVPVRAMVLAMRKAGVPADVSDAAGTFVCNHLMYGVLHHLAQKGLPVRAGWIHLPCLPSVAALDHNLGVPSMSVQTAVAGVTAGIEAAIRQSADIREPIPSRLQI