Rv0315 Resolved · high auto-curated

H37Rv Rv0315 · MTBC0 mtbc0_000335 · 294 aa · 386925–387809 (+) · RefSeq NP_214829.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)beta-1,3-glucanase
MTBC0 PGAP re-annotationfamily 16 glycosylhydrolase
Revised (this work)Family 16 glycosylhydrolase. Pfam: Glyco_hydro_16 (PF00722.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07242 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible beta-1,3-glucanase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category G Carbohydrate transport and metabolism
eggNOG descriptionfamily 16
Orthologous groupCOG2273

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.314 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.22% of strains (314) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Glyco_hydro_16PF00722.29 5.6e-10141–226 Glycosyl hydrolases family 16

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0316 (muconolactone isomerase), high confidence from genomic context alone (score 843 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0316 muconolactone isomerase 843 843 ctx neighborhood:714 coexpression:474
Rv0314c membrane protein 757 757 ctx neighborhood:755
Rv3810 pirG cell surface protein 698 699 ctx cooccurence:692
Rv3707c hyp hypothetical protein 673 673 ctx cooccurence:672
Rv1987 chitinase 662 617 ctx cooccurence:602
Rv0290 eccD3 ESX-3 secretion system protein EccD 580 580 ctx cooccurence:576
Rv2743c hyp hypothetical protein 558 558 ctx cooccurence:557
Rv2120c integral membrane protein 520 521 ctx cooccurence:514
Rv3593 lpqF lipoprotein LpqF 506 504 ctx cooccurence:501
Rv0262c aac aminoglycoside 2'-N-acetyltransferase 500 501 ctx cooccurence:499
Rv1288 hyp hypothetical protein 474 474 ctx cooccurence:470
Rv1836c hyp hypothetical protein 444 444 ctx cooccurence:432
Rv0817c lmeA hyp hypothetical protein 442 443 ctx cooccurence:441
Rv0273c transcriptional regulator 434 435 ctx cooccurence:434
Rv3630 integral membrane protein 462 429

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: beta-1,3-glucanase
  • MTBC0 PGAP product: family 16 glycosylhydrolase
  • Pfam (hmmscan --cut_ga): Glyco_hydro_16 PF00722.29 (E=6e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214829.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Glyco_hydro_16 (PF00722.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2273
  • Curated reference: UniProt O07242 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 39 functional partner(s); context anchor Rv0316
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000335|Rv0315|
MLMPEMDRRRMMMMAGFGALAAALPAPTAWADPSRPAAPAGPTPAPAAPAAATGGLLFHDEFDGPAGSVPDPSKWQVSNHRTPIKNPVGFDRPQFFGQYRDSRQNVFLDGNSNLVLRATREGNRYFGGLVHGLWRGGIGTTWEARIKFNCLAPGMWPAWWLSNDDPGRSGEIDLIEWYGNGTWPSGTTVHANPDGTAFETCPIGVDGGWHNWRVTWNPSGMYFWLDYADGIEPYFSVPATGIEDLNEPIREWPFNDPGYTVFPVLNLAVGGSGGGDPATGSYPQEMLVDWVRVF