fbpD Resolved · high auto-curated
H37Rv Rv3803c · MTBC0 - ·
299 aa · 4264563–4265462 (-) ·
RefSeq YP_178017.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | MPT51/MPB51 antigen |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | MPT51/MPB51 antigen. Pfam: Esterase (PF00756.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WQN7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | MPT51/MPB51 antigen |
| Curated function | May have a role in host tissue attachment, whereby ligands may include the serum protein fibronectin and small sugars. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | cmtB |
| eggNOG description | esterase |
| Orthologous group | COG0627 |
| EC number |
EC 2.3.1.122, EC 2.3.1.20
|
| KEGG orthology |
K18851
|
| KEGG pathways |
map00561, map01100
|
| KEGG modules |
M00089
|
| Gene Ontology (8) |
GO:0001968, GO:0003674, GO:0005488, GO:0005515, GO:0005575, GO:0005576, GO:0019899, GO:0035375
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.643 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Esterase | PF00756.27 | 4.3e-48 | 43–293 | Putative esterase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv3802c (membrane protein), high confidence from genomic context alone (score 888 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3802c |
membrane protein | 891 | 888 ctx | neighborhood:737 cooccurence:589 |
Rv3668c |
protease | 602 | 603 ctx | cooccurence:600 |
Rv2721c hyp |
hypothetical protein | 594 | 594 ctx | cooccurence:588 |
Rv3804c fbpA |
diacylglycerol acyltransferase/mycolyltransferase Ag85A | 635 | 591 ctx | neighborhood:521 |
Rv3035 hyp |
hypothetical protein | 588 | 589 ctx | cooccurence:582 |
Rv0412c glnX |
membrane protein | 601 | 586 | coexpression:407 |
Rv3805c aftB |
terminal beta-(1->2)-arabinofuranosyltransferase | 586 | 586 | |
Rv3444c esxT |
ESAT-6 like protein EsxT | 582 | 582 ctx | cooccurence:581 |
Rv0228 |
acyltransferase | 568 | 568 ctx | cooccurence:565 |
Rv3244c lpqB |
lipoprotein LpqB | 559 | 559 ctx | cooccurence:557 |
Rv0761c adhB |
alcohol dehydrogenase B | 570 | 551 | coexpression:472 |
Rv3800c pks13 |
polyketide synthase | 582 | 535 | |
Rv3810 pirG |
cell surface protein | 539 | 535 ctx | cooccurence:440 |
Rv3086 adhD |
alcohol dehydrogenase D | 546 | 526 | coexpression:443 |
Rv2259 mscR |
S-nitrosomycothiol reductase MscR | 546 | 526 | coexpression:443 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): MPT51/MPB51 antigen
- Pfam (hmmscan --cut_ga): Esterase PF00756.27 (E=4e-48)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_178017.1)
- Domains: Pfam-A via hmmscan --cut_ga — Esterase (PF00756.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0627 - Curated reference: UniProt P9WQN7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
54 functional partner(s); context anchor
Rv3802c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3803c|fbpD MKGRSALLRALWIAALSFGLGGVAVAAEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR