fbpD Resolved · high auto-curated

H37Rv Rv3803c · MTBC0 - · 299 aa · 4264563–4265462 (-) · RefSeq YP_178017.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)MPT51/MPB51 antigen
MTBC0 PGAP re-annotation
Revised (this work)MPT51/MPB51 antigen. Pfam: Esterase (PF00756.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WQN7 SwissProt · reviewed · Evidence at protein level
UniProt nameMPT51/MPB51 antigen
Curated functionMay have a role in host tissue attachment, whereby ligands may include the serum protein fibronectin and small sugars.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namecmtB
eggNOG descriptionesterase
Orthologous groupCOG0627
EC number EC 2.3.1.122, EC 2.3.1.20
KEGG orthology K18851
KEGG pathways map00561, map01100
KEGG modules M00089
Gene Ontology (8) GO:0001968, GO:0003674, GO:0005488, GO:0005515, GO:0005575, GO:0005576, GO:0019899, GO:0035375

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.643 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
EsterasePF00756.27 4.3e-4843–293 Putative esterase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3802c (membrane protein), high confidence from genomic context alone (score 888 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3802c membrane protein 891 888 ctx neighborhood:737 cooccurence:589
Rv3668c protease 602 603 ctx cooccurence:600
Rv2721c hyp hypothetical protein 594 594 ctx cooccurence:588
Rv3804c fbpA diacylglycerol acyltransferase/mycolyltransferase Ag85A 635 591 ctx neighborhood:521
Rv3035 hyp hypothetical protein 588 589 ctx cooccurence:582
Rv0412c glnX membrane protein 601 586 coexpression:407
Rv3805c aftB terminal beta-(1->2)-arabinofuranosyltransferase 586 586
Rv3444c esxT ESAT-6 like protein EsxT 582 582 ctx cooccurence:581
Rv0228 acyltransferase 568 568 ctx cooccurence:565
Rv3244c lpqB lipoprotein LpqB 559 559 ctx cooccurence:557
Rv0761c adhB alcohol dehydrogenase B 570 551 coexpression:472
Rv3800c pks13 polyketide synthase 582 535
Rv3810 pirG cell surface protein 539 535 ctx cooccurence:440
Rv3086 adhD alcohol dehydrogenase D 546 526 coexpression:443
Rv2259 mscR S-nitrosomycothiol reductase MscR 546 526 coexpression:443

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): MPT51/MPB51 antigen
  • Pfam (hmmscan --cut_ga): Esterase PF00756.27 (E=4e-48)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_178017.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Esterase (PF00756.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0627
  • Curated reference: UniProt P9WQN7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 54 functional partner(s); context anchor Rv3802c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3803c|fbpD
MKGRSALLRALWIAALSFGLGGVAVAAEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR