Rv0323c Family assigned · medium auto-curated
H37Rv Rv0323c · MTBC0 mtbc0_000344 ·
223 aa · 393903–394574 (-) ·
RefSeq NP_214837.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | PIG-L deacetylase family protein |
| Revised (this work) | PIG-L deacetylase family protein. Pfam: PIG-L (PF02585.23). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
L0T643
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein |
UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | GlcNAc-PI de-N-acetylase |
| Orthologous group | COG2120 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PIG-L | PF02585.23 | 8.2e-31 | 14–137 | GlcNAc-PI de-N-acetylase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0324 (transcriptional regulator), medium confidence from genomic context alone (score 601 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0326 hyp |
hypothetical protein | 637 | 637 ctx | neighborhood:551 |
Rv0324 |
transcriptional regulator | 601 | 601 ctx | neighborhood:596 |
Rv0325 hyp |
hypothetical protein | 569 | 570 ctx | neighborhood:559 |
Rv2466c hyp |
hypothetical protein | 467 | 467 ctx | cooccurence:440 |
Rv2133c hyp |
hypothetical protein | 459 | 459 ctx | cooccurence:456 |
Rv0613c hyp |
hypothetical protein | 438 | 439 ctx | cooccurence:437 |
Rv2286c hyp |
hypothetical protein | 411 | 411 ctx | cooccurence:400 |
Rv0486 mshA |
D-inositol 3-phosphate glycosyltransferase | 423 | 347 | |
Rv0819 mshD |
mycothiol acetyltransferase | 554 | 270 | textmining:415 |
Rv2130c mshC |
cysteine:1D-myo-inosityl 2-amino-2-deoxy--D-glucopyranoside ligase | 528 | 226 | textmining:415 |
Rv0404 fadD30 |
long-chain-fatty-acid--AMP ligase FadD30 | 527 | 59 | textmining:518 |
Rv0565c |
monooxygenase | 627 | 50 | textmining:624 |
Rv1699 pyrG |
CTP synthase | 514 | 47 | textmining:511 |
Rv2080 lppJ |
lipoprotein LppJ | 651 | 44 | textmining:650 |
Rv3756c proZ |
glycine betaine/carnitine/choline/L-proline ABC transporter permease ProZ | 631 | 44 | textmining:630 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: PIG-L deacetylase family protein
- Pfam (hmmscan --cut_ga): PIG-L PF02585.23 (E=8e-31)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214837.1)
- Domains: Pfam-A via hmmscan --cut_ga — PIG-L (PF02585.23)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2120 - Curated reference: UniProt L0T643 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
15 functional partner(s); context anchor
Rv0324 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000344|Rv0323c| MNSCNRLPCAHEVLAVFAHPDDESFGLGAVLGDFTAQGTRLRGLCFTHGEASTLGRTDRNLGEVRREELAAAAQVLGVDHVQLLAYPDNGLAQIPLNELTQRVVDALAGADLLLVFDDNGVTGHPDHRRATEAALAAASTPGIPVLAWALPQPIADRLNAEFSASFGGRGHGHLDIMIEVDRSRQLAAIGCHFTQSADNPVLWRRLELLGDREYLRWLRRSVP