Rv0323c Family assigned · medium auto-curated

H37Rv Rv0323c · MTBC0 mtbc0_000344 · 223 aa · 393903–394574 (-) · RefSeq NP_214837.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationPIG-L deacetylase family protein
Revised (this work)PIG-L deacetylase family protein. Pfam: PIG-L (PF02585.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt L0T643 TrEMBL · unreviewed · Evidence at protein level
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionGlcNAc-PI de-N-acetylase
Orthologous groupCOG2120

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PIG-LPF02585.23 8.2e-3114–137 GlcNAc-PI de-N-acetylase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0324 (transcriptional regulator), medium confidence from genomic context alone (score 601 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0326 hyp hypothetical protein 637 637 ctx neighborhood:551
Rv0324 transcriptional regulator 601 601 ctx neighborhood:596
Rv0325 hyp hypothetical protein 569 570 ctx neighborhood:559
Rv2466c hyp hypothetical protein 467 467 ctx cooccurence:440
Rv2133c hyp hypothetical protein 459 459 ctx cooccurence:456
Rv0613c hyp hypothetical protein 438 439 ctx cooccurence:437
Rv2286c hyp hypothetical protein 411 411 ctx cooccurence:400
Rv0486 mshA D-inositol 3-phosphate glycosyltransferase 423 347
Rv0819 mshD mycothiol acetyltransferase 554 270 textmining:415
Rv2130c mshC cysteine:1D-myo-inosityl 2-amino-2-deoxy--D-glucopyranoside ligase 528 226 textmining:415
Rv0404 fadD30 long-chain-fatty-acid--AMP ligase FadD30 527 59 textmining:518
Rv0565c monooxygenase 627 50 textmining:624
Rv1699 pyrG CTP synthase 514 47 textmining:511
Rv2080 lppJ lipoprotein LppJ 651 44 textmining:650
Rv3756c proZ glycine betaine/carnitine/choline/L-proline ABC transporter permease ProZ 631 44 textmining:630

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: PIG-L deacetylase family protein
  • Pfam (hmmscan --cut_ga): PIG-L PF02585.23 (E=8e-31)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214837.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PIG-L (PF02585.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2120
  • Curated reference: UniProt L0T643 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s); context anchor Rv0324
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000344|Rv0323c|
MNSCNRLPCAHEVLAVFAHPDDESFGLGAVLGDFTAQGTRLRGLCFTHGEASTLGRTDRNLGEVRREELAAAAQVLGVDHVQLLAYPDNGLAQIPLNELTQRVVDALAGADLLLVFDDNGVTGHPDHRRATEAALAAASTPGIPVLAWALPQPIADRLNAEFSASFGGRGHGHLDIMIEVDRSRQLAAIGCHFTQSADNPVLWRRLELLGDREYLRWLRRSVP