Rv0887c Family assigned · medium auto-curated

H37Rv Rv0887c · MTBC0 mtbc0_000942 · 152 aa · 988727–989185 (-) · RefSeq NP_215402.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationVOC family protein
Revised (this work)VOC family protein. Pfam: Glyoxalase (PF00903.32), Glyoxalase_6 (PF18029.8).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKQ3 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv0887c

UniProt still lists this protein as Uncharacterized protein Rv0887c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionGlyoxalase bleomycin resistance protein dioxygenase
Orthologous groupCOG2764
KEGG orthology K04750

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.325 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GlyoxalasePF00903.32 4.8e-1613–129 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
Glyoxalase_6PF18029.8 2.3e-0814–129 Glyoxalase-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: sigI (ECF RNA polymerase sigma factor SigI), high confidence from genomic context alone (score 831 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1931c transcriptional regulator 858 858 coexpression:801
Rv1190 hyp hypothetical protein 835 836 coexpression:799
Rv1725c hyp hypothetical protein 834 835 coexpression:797
Rv1189 sigI ECF RNA polymerase sigma factor SigI 831 831 ctx cooccurence:431 coexpression:716
Rv3082c virS HTH-type transcriptional regulator VirS 829 830 coexpression:796
Rv2488c LuxR family transcriptional regulator 816 817 coexpression:817
Rv1674c transcriptional regulator 810 811 coexpression:800
Rv0494 HTH-type transcriptional regulator 798 798 coexpression:798
Rv1675c cmr HTH-type transcriptional regulator Cmr 797 797 coexpression:797
Rv1027c kdpE transcriptional regulator KdpE 797 797 coexpression:797
Rv1267c embR transcriptional regulator EmbR 797 797 coexpression:797
Rv3736 AraC/XylS family transcriptional regulator 786 787 coexpression:749
Rv0117 oxyS oxidative stress response regulatory protein OxyS 761 761 coexpression:761
Rv1151c cobB NAD-dependent protein deacylase 741 742 coexpression:733
Rv3167c TetR family transcriptional regulator 738 738 coexpression:734

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: VOC family protein
  • Pfam (hmmscan --cut_ga): Glyoxalase PF00903.32 (E=5e-16), Glyoxalase_6 PF18029.8 (E=2e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215402.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Glyoxalase (PF00903.32), Glyoxalase_6 (PF18029.8)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2764
  • Curated reference: UniProt P9WKQ3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 56 functional partner(s); context anchor sigI
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000942|Rv0887c|
MAINVEPALSPHLVVDDAASAIDFYVKAFDAVELGRVPGPDGKLIHAALRINGFTVMLNDDVPQMCGGKSMTPTSLGGTPVTIHLTVTDVDAKFQRALNAGATVVTALEDQLWGDRYGVVADPFGHHWSLGQPVREVNMDEIQAAMSSQGDG