mce1F Family assigned · medium auto-curated
H37Rv Rv0174 · MTBC0 mtbc0_000187 ·
515 aa · 205579–207126 (+) ·
RefSeq NP_214688.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | Mce family protein Mce1F |
|---|---|
| MTBC0 PGAP re-annotation | MCE family protein |
| Revised (this work) | MCE family protein. Pfam: MlaD (PF02470.26), Mce4_CUP1 (PF11887.14). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
L0T2W6
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Mce-family protein Mce1F |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| Preferred name | mce1F |
| eggNOG description | Virulence factor Mce family protein |
| Orthologous group | COG1463 |
| KEGG orthology |
K02067
|
| KEGG pathways |
map02010
|
| KEGG modules |
M00210, M00669, M00670
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.37 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 8 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MlaD | PF02470.26 | 1.6e-17 | 39–112 | MlaD protein |
Mce4_CUP1 | PF11887.14 | 1.3e-08 | 122–286 | Cholesterol uptake porter CUP1 of Mce4, putative |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mce1B (Mce family protein Mce1B), high confidence from genomic context alone (score 996 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0170 mce1B |
Mce family protein Mce1B | 999 | 996 ctx | neighborhood:881 cooccurence:772 coexpression:849 textmining:869 |
Rv0167 yrbE1A |
membrane protein | 999 | 996 ctx | neighborhood:867 cooccurence:741 coexpression:849 textmining:909 |
Rv0173 lprK |
Mce family lipoprotein LprK | 995 | 993 ctx | neighborhood:799 cooccurence:774 coexpression:860 |
Rv0169 mce1A |
Mce family protein Mce1A | 998 | 990 ctx | neighborhood:785 cooccurence:774 coexpression:805 textmining:828 |
Rv0171 mce1C |
Mce family protein Mce1C | 988 | 983 ctx | neighborhood:881 coexpression:806 |
Rv0168 yrbE1B |
membrane protein | 992 | 977 ctx | neighborhood:799 cooccurence:759 textmining:676 |
Rv0172 mce1D |
Mce family protein Mce1D | 977 | 974 ctx | neighborhood:787 coexpression:834 |
Rv0587 yrbE2A hyp |
hypothetical protein | 914 | 888 ctx | cooccurence:734 |
Rv0655 mkl |
ABC transporter ATP-binding protein | 900 | 880 ctx | cooccurence:711 experimental:431 |
Rv1965 yrbE3B |
integral membrane protein | 880 | 874 ctx | cooccurence:754 |
Rv3501c yrbE4A |
integral membrane protein | 914 | 869 ctx | cooccurence:744 |
Rv3500c yrbE4B |
integral membrane protein | 874 | 867 ctx | cooccurence:761 |
Rv0588 yrbE2B hyp |
hypothetical protein | 869 | 864 ctx | cooccurence:757 |
Rv0176 |
Mce associated transmembrane protein | 926 | 845 ctx | neighborhood:713 cooccurence:408 textmining:543 |
Rv0178 |
Mce associated membrane protein | 924 | 840 ctx | neighborhood:829 textmining:548 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: Mce family protein Mce1F
- MTBC0 PGAP product: MCE family protein
- Pfam (hmmscan --cut_ga): MlaD PF02470.26 (E=2e-17), Mce4_CUP1 PF11887.14 (E=1e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214688.1)
- Domains: Pfam-A via hmmscan --cut_ga — MlaD (PF02470.26), Mce4_CUP1 (PF11887.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1463 - Curated reference: UniProt L0T2W6 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
69 functional partner(s); context anchor
mce1B - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000187|Rv0174|mce1F MLTRFIRRQLILFAIVSVVAIVVLGWYYLRIPSLVGIGQYTLKADLPASGGLYPTANVTYRGITIGKVTAVEPTDQGARVTMSIASNYKIPVDASANVHSVSAVGEQYIDLVSTGAPGKYFSSGQTITKGTVPSEIGPALDNSNRGLAALPTEKIGLLLDETAQAVGGLGPALQRLVDSTQAIVGDFKTNIGDVNDIIENSGPILDSQVNTGDQIERWARKLNNLAAQTATRDQNVRSILSQAAPTADEVNAVFSGVRDSLPQTLANLEVVFDMLKRYHAGVEQLLVFLPQGAAIAQTVLTPTPGAAQLPLAPAINYPPPCLTGFLPASEWRSPADTSPRPLPSGTYCKIPQDAQLQVRGARNIPCVDVPGKRAATPKECRSKDPYVPLGTNPWFGDPNQILTCPAPGARCDQPVKPGLVIPAPSINTGLNPAPADQVQGTPPPVSDPLQRPGSGTVQCNGQQPNPCVYTPTSGPSAVYSPASGELVGPDGVKYAVANSSTTGDDGWKEMLAPAS