mce1F Family assigned · medium auto-curated
H37Rv Rv0174 · MTBC0 mtbc0_000187 ·
515 aa ·
205579–207126 MTBC0
(+) ·
RefSeq NP_214688.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | Mce family protein Mce1F |
|---|---|
| MTBC0 PGAP re-annotation | MCE family protein |
| Revised (this work) | MCE family protein. Pfam: MlaD (PF02470.26), Mce4_CUP1 (PF11887.14). |
| Functional category (TubercuList) | virulence, detoxification, adaptation |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 4 publications
4 TB publications mention this gene. 4 publication(s) discuss this gene (4 in a M. tuberculosis context, 1 in other mycobacteria — M. leprae (1), M. smegmatis (1)).
| Publication | Date |
|---|---|
| Immunodominant B-cell epitope in the Mce1A mammalian cell entry protein of Mycobacterium tuberculosis cross-reacting with glutathione S-transferase. doi:10.1111/j.0300-9475.2004.01383.x | 2004 |
| Expression of the mceA, esat-6 and hspX genes in Mycobacterium tuberculosis and their responses to aerobic conditions and to restricted oxygen supply. doi:10.1099/00221287-148-12-3881 | 2002 |
| Cross-reaction between mammalian cell entry (Mce) proteins of Mycobacterium tuberculosis. doi:10.1046/j.1365-3083.2002.01172.x | 2002 |
| Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme-linked immunosorbent assay and reverse transcription-polymerase chain reaction. doi:10.1046/j.1365-3083.1999.00632.x | 1999 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | lprK (Rv0173, + strand) |
|---|---|
| Overlap | 7 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 0.77 (95% CI -1.52 to 4.18). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Unknown, but thought involved in host cell invasion. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0180
· 99.8% identity |
|---|---|
| M. leprae |
ML2594
· 76.5% identity |
| M. marinum |
MMAR_0417
· 77.6% identity |
| M. smegmatis |
MSMEG_0139
· 69.2% identity |
| M. orygis |
RJtmp_000188
· 99.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
L0T2W6
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Mce-family protein Mce1F |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| Preferred name | mce1F |
| eggNOG description | Virulence factor Mce family protein |
| Orthologous group | COG1463 |
| KEGG orthology |
K02067
|
| KEGG pathways |
map02010
|
| KEGG modules |
M00210, M00669, M00670
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.37 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 8 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| M. canettii dN/dS (deep-divergence selection) |
0.06
· 32 consensus substitution(s) under purifying selection vs M. canettii (deep divergence; dN/dS=0.06) — a real, constrained gene predating the MTBC clonal expansion |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 77.7%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 4/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 37.5% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 31 in the ORF — 0 in the essential state, 0 growth-defect, 31 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 145.709677419. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Conditional fitness (RB-TnSeq, 95 conditions) carbon sourcestress
| Condition | Group | Direction | log2 fitness | t |
|---|---|---|---|---|
| heptadecanoic acid | carbon source | mutant depleted (gene required) | -1.522 | -7.531 |
| Stearic acid | carbon source | mutant depleted (gene required) | -1.625 | -6.876 |
| Bedaquiline | stress | mutant depleted (gene required) | -1.576 | -6.155 |
Randomly-barcoded transposon screen across 95 carbon/nitrogen sources, pH, stressors and antibiotics (3 condition-specific phenotype(s) for this gene). A conditional fitness phenotype is a context lead, not a proven function, and never changes the verdict here. Note the blind spot: RB-TnSeq cannot measure essential genes. Source: RB-TnSeq 95-condition barcoded transposon screen, Mtb (PLoS Biol 2026, doi:10.1371/journal.pbio.3003529).
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | -2.99 | 0.0 | required |
| fitness in mouse infection (in vivo) | -2.80 | 0.0 | required |
| fitness in mouse infection (in vivo) | -2.53 | 0.0 | required |
| fitness in mouse infection (in vivo) | -2.05 | 0.047 | required |
| fitness in mouse infection (in vivo) | -1.93 | 0.0 | required |
| fitness in mouse infection (in vivo) | -1.89 | 0.0 | required |
| fitness in mouse infection (in vivo) | -1.78 | 0.0 | required |
| fitness in mouse infection (in vivo) | -1.57 | 0.0075 | required |
| fitness in mouse infection (in vivo) | -1.50 | 0.0098 | required |
| fitness in mouse infection (in vivo) | -1.25 | 0.011 | required |
| fitness in mouse infection (in vivo) | -1.18 | 0.018 | required |
| fitness in mouse infection (in vivo) | -1.15 | 0.048 | required |
Conditional fitness of transposon-disruption mutants across 16 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 12 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 280.0 ppm · rank 678/3519 (80.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (1 TM helix) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 1 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 515 aa |
|---|---|
| Molecular weight | 54.0 kDa |
| Theoretical pI | 5.61 |
| GRAVY | -0.097 (hydrophilic) |
| Aliphatic index | 89.6 |
| Aromaticity | 0.056 |
| Instability index | 40.3 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MlaD | PF02470.26 | 1.6e-17 | 39–112 | MlaD protein |
Mce4_CUP1 | PF11887.14 | 1.3e-08 | 122–286 | Cholesterol uptake porter CUP1 of Mce4, putative |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 81.4
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8fee-assembly1_F |
1.00 | 0.41 | 2.3e-48 sig | 8fee-assembly1_F Structure of Mce1 transporter from Mycobacterium smegmatis in the absence of LucB (Map2) |
8hqa-assembly1_A-3 |
1.00 | 0.87 | 4.6e-09 sig | 8hqa-assembly1_A-3 Crystal structure of the ectodomain of the MlaD protein from Escherichia coli in the resting state |
8fee-assembly1_B |
1.00 | 0.40 | 1.7e-12 sig | 8fee-assembly1_B Structure of Mce1 transporter from Mycobacterium smegmatis in the absence of LucB (Map2) |
8fef-assembly1_C |
1.00 | 0.37 | 3.2e-13 sig | 8fef-assembly1_C Structure of Mce1 transporter from Mycobacterium smegmatis (Map0) |
8fef-assembly1_D |
1.00 | 0.38 | 9.7e-13 sig | 8fef-assembly1_D Structure of Mce1 transporter from Mycobacterium smegmatis (Map0) |
Foldseek search of the AlphaFold DB model (mean pLDDT 81.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 12
| Upstream (5' on genome) | lprK (+ strand, -7 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0175 (+ strand, 35 bp gap) |
| Predicted operon |
yrbE1A · yrbE1B · mce1A · mce1B · mce1C · mce1D · lprK · mce1F · Rv0175 · Rv0176 · Rv0177 · Rv0178
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (9 TF) |
Rv0023 (represses) · Rv0081 (represses) · Rv1049 (represses) · sigI (activates) · Rv1719 (activates) · Rv1816 (represses) · Rv1985c (activates) · Rv2011c (represses) · whiB3 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: mce1B (Mce family protein Mce1B), high confidence from genomic context alone (score 996 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0170 mce1B |
Mce family protein Mce1B | 999 | 996 ctx | neighborhood:881 cooccurence:772 coexpression:849 textmining:869 |
Rv0167 yrbE1A |
membrane protein | 999 | 996 ctx | neighborhood:867 cooccurence:741 coexpression:849 textmining:909 |
Rv0173 lprK |
Mce family lipoprotein LprK | 995 | 993 ctx | neighborhood:799 cooccurence:774 coexpression:860 |
Rv0169 mce1A |
Mce family protein Mce1A | 998 | 990 ctx | neighborhood:785 cooccurence:774 coexpression:805 textmining:828 |
Rv0171 mce1C |
Mce family protein Mce1C | 988 | 983 ctx | neighborhood:881 coexpression:806 |
Rv0168 yrbE1B |
membrane protein | 992 | 977 ctx | neighborhood:799 cooccurence:759 textmining:676 |
Rv0172 mce1D |
Mce family protein Mce1D | 977 | 974 ctx | neighborhood:787 coexpression:834 |
Rv0587 yrbE2A hyp |
hypothetical protein | 914 | 888 ctx | cooccurence:734 |
Rv0655 mkl exp |
ABC transporter ATP-binding protein | 900 | 880 ctx | cooccurence:711 experimental:431 |
Rv1965 yrbE3B |
integral membrane protein | 880 | 874 ctx | cooccurence:754 |
Rv3501c yrbE4A |
integral membrane protein | 914 | 869 ctx | cooccurence:744 |
Rv3500c yrbE4B |
integral membrane protein | 874 | 867 ctx | cooccurence:761 |
Rv0588 yrbE2B hyp |
hypothetical protein | 869 | 864 ctx | cooccurence:757 |
Rv0176 |
Mce associated transmembrane protein | 926 | 845 ctx | neighborhood:713 cooccurence:408 textmining:543 |
Rv0178 |
Mce associated membrane protein | 924 | 840 ctx | neighborhood:829 textmining:548 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: Mce family protein Mce1F
- MTBC0 PGAP product: MCE family protein
- Pfam (hmmscan --cut_ga): MlaD PF02470.26 (E=2e-17), Mce4_CUP1 PF11887.14 (E=1e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214688.1)
- Domains: Pfam-A via hmmscan --cut_ga — MlaD (PF02470.26), Mce4_CUP1 (PF11887.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1463 - Curated reference: UniProt L0T2W6 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 81.4)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
69 functional partner(s); context anchor
mce1B - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000187|Rv0174|mce1F MLTRFIRRQLILFAIVSVVAIVVLGWYYLRIPSLVGIGQYTLKADLPASGGLYPTANVTYRGITIGKVTAVEPTDQGARVTMSIASNYKIPVDASANVHSVSAVGEQYIDLVSTGAPGKYFSSGQTITKGTVPSEIGPALDNSNRGLAALPTEKIGLLLDETAQAVGGLGPALQRLVDSTQAIVGDFKTNIGDVNDIIENSGPILDSQVNTGDQIERWARKLNNLAAQTATRDQNVRSILSQAAPTADEVNAVFSGVRDSLPQTLANLEVVFDMLKRYHAGVEQLLVFLPQGAAIAQTVLTPTPGAAQLPLAPAINYPPPCLTGFLPASEWRSPADTSPRPLPSGTYCKIPQDAQLQVRGARNIPCVDVPGKRAATPKECRSKDPYVPLGTNPWFGDPNQILTCPAPGARCDQPVKPGLVIPAPSINTGLNPAPADQVQGTPPPVSDPLQRPGSGTVQCNGQQPNPCVYTPTSGPSAVYSPASGELVGPDGVKYAVANSSTTGDDGWKEMLAPAS
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for mce1F? Email the maintainer — the message is pre-filled with this gene's details.