vapB15 Resolved · high auto-curated

H37Rv Rv2009 · MTBC0 - · 80 aa · 2258030–2258272 (+) · RefSeq NP_216525.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin VapB15
MTBC0 PGAP re-annotation
Revised (this work)Antitoxin VapB15. Pfam: VapB_antitoxin (PF09957.16).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WLM7 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin VapB15
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC15. Partially inhibits the RNase activity of VapC15.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionpositive regulation of growth
Orthologous groupCOG5450
Gene Ontology (12) GO:0001666, GO:0006950, GO:0008150, GO:0009628, GO:0036293, GO:0040008, GO:0045927, GO:0048518, GO:0050789, GO:0050896, GO:0065007, GO:0070482

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
VapB_antitoxinPF09957.16 5.3e-177–50 Bacterial antitoxin of type II TA system, VapB

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC15 (ribonuclease VapC15), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2010 vapC15 ribonuclease VapC15 999 1000 ctx neighborhood:882 experimental:999 textmining:888
Rv1561 vapC11 ribonuclease VapC11 872 872 experimental:853
Rv2008c hyp hypothetical protein 600 600 ctx neighborhood:600
Rv0301 vapC2 ribonuclease VapC2 643 240 textmining:550
Rv0627 vapC5 ribonuclease VapC5 717 224 textmining:651
Rv0595c vapC4 ribonuclease VapC4 449 220
Rv0626 vapB5 antitoxin VapB5 705 71 textmining:696
Rv0623 vapB30 antitoxin VapB30 813 63 textmining:809
Rv2865 relF antitoxin RelF 443 56 textmining:435
Rv0300 vapB2 antitoxin VapB2 805 55 textmining:803
Rv2493 vapB38 antitoxin VapB38 522 55 textmining:515
Rv1247c relB antitoxin RelB 629 53 textmining:625
Rv0624 vapC30 ribonuclease VapC30 657 50 textmining:654
Rv0181c hyp hypothetical protein 654 47 textmining:652
Rv0912 transmembrane protein 653 47 textmining:651

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): antitoxin VapB15
  • Pfam (hmmscan --cut_ga): VapB_antitoxin PF09957.16 (E=5e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216525.1)
  • Domains: Pfam-A via hmmscan --cut_ga — VapB_antitoxin (PF09957.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5450
  • Curated reference: UniProt P9WLM7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 27 functional partner(s); context anchor vapC15
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2009|vapB15
MYSGVVSRTNIEIDDELVAAAQRMYRLDSKRSAVDLALRRLVGEPLGRDEALALQGSGFDFSNDEIESFSDTDRKLADES