egtD Resolved · high auto-curated

H37Rv Rv3701c · MTBC0 mtbc0_003923 · 321 aa · 4167899–4168864 (-) · RefSeq NP_218218.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)histidine-specific methyltransferase EtgD
MTBC0 PGAP re-annotationL-histidine N(alpha)-methyltransferase
Revised (this work)L-histidine N(alpha)-methyltransferase. Pfam: Methyltransf_33 (PF10017.16).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WN47 SwissProt · reviewed · Evidence at protein level
UniProt nameHistidine N-alpha-methyltransferase
EC (curated) EC 2.1.1.44
Curated functionCatalyzes the SAM-dependent triple methylation of the alpha-amino group of histidine to form hercynine, a step in the biosynthesis pathway of ergothioneine.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameegtD
eggNOG descriptionCatalyzes the SAM-dependent triple methylation of the alpha-amino group of histidine to form hercynine, a step in the biosynthesis pathway of ergothioneine
Orthologous groupCOG4301
EC number EC 2.1.1.44
KEGG orthology K18911
KEGG pathways map00340
Gene Ontology (86) GO:0000096, GO:0000097, GO:0003674, GO:0003824, GO:0005575, GO:0005623, GO:0005886, GO:0006082, GO:0006464, GO:0006479, GO:0006520, GO:0006547 +74 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.137 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 1 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.15% of strains (215) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Methyltransf_33PF10017.16 6.0e-11419–320 Histidine-specific methyltransferase, SAM-dependent

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: etgB (iron(II)-dependent oxidoreductase EgtB), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3703c etgB iron(II)-dependent oxidoreductase EgtB 999 1000 ctx neighborhood:881 fusion:893 cooccurence:773 coexpression:811 database:900 textmining:745
Rv3702c egtC amidohydrolase EgtC 996 995 ctx neighborhood:882 fusion:577 cooccurence:472 coexpression:819
Rv3704c gshA glutamate--cysteine ligase 989 973 ctx neighborhood:882 coexpression:733 textmining:616
Rv3700c egtE pyridoxal-phosphate-dependent protein EgtE 982 955 ctx neighborhood:839 coexpression:734 textmining:623
Rv1599 hisD histidinol dehydrogenase 900 900 database:900
Rv1861 transmembrane protein 645 645 coexpression:645
Rv3705c hyp hypothetical protein 561 561 ctx neighborhood:555
Rv1670 hyp hypothetical protein 524 524 ctx cooccurence:506
Rv0140 hyp hypothetical protein 467 468 ctx cooccurence:447
Rv0925c hyp hypothetical protein 444 445 ctx cooccurence:411
Rv0712 hyp hypothetical protein 639 246 textmining:541
Rv3680 anion transporter ATPase 706 194 textmining:651
Rv1464 csd cysteine desulfurase 423 159
Rv2421c nadD nicotinate-nucleotide adenylyltransferase 538 101 textmining:508
Rv2593c ruvA Holliday junction ATP-dependent DNA helicase RuvA 432 55 textmining:424

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: histidine-specific methyltransferase EtgD
  • MTBC0 PGAP product: L-histidine N(alpha)-methyltransferase
  • Pfam (hmmscan --cut_ga): Methyltransf_33 PF10017.16 (E=6e-114)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218218.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Methyltransf_33 (PF10017.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4301
  • Curated reference: UniProt P9WN47 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 27 functional partner(s); context anchor etgB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003923|Rv3701c|egtD
MRVSVANHLGEDAGHLALRRDVYSGLQKTPKSLPPKWFYDTVGSELFDQITRLPEYYPTRAEAEILRARSAEVASACRADTLVELGSGTSEKTRMLLDALRHRGSLRRFVPFDVDASVLSATATAIQREYSGVEINAVCGDFEEHLTEIPRGGRRLFVFLGSTIGNLTPGPRAQFLTALAGVMRPGDSLLLGTDLVKDAARLVRAYDDPGGVTAQFNRNVLAVINRELEADFDVDAFQHVARWNSAEERIEMWLRADGRQRVRVGALDLTVDFDAGEEMLTEVSCKFRPQAVGAELAAAGLHRIRWWTDEAGDFGLSLAAK