ilvC Resolved · high auto-curated

H37Rv Rv3001c · MTBC0 mtbc0_003190 · 333 aa · 3380894–3381895 MTBC0 (-) · RefSeq NP_217517.3

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ketol-acid reductoisomerase
MTBC0 PGAP re-annotationketol-acid reductoisomerase
Revised (this work)Ketol-acid reductoisomerase. Pfam: KARI_N (PF07991.19), 2-Hacid_dh_C (PF02826.26), NAD_binding_2 (PF03446.22), KARI_C (PF01450.26).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 4 publications

4 TB publications mention this gene. 4 publication(s) discuss this gene (3 in a M. tuberculosis context).

PublicationDate
A d-Phenylalanine-Benzoxazole Derivative Reveals the Role of the Essential Enzyme Rv3603c in the Pantothenate Biosynthetic Pathway of Mycobacterium tuberculosis. doi:10.1021/acsinfecdis.1c00461 2022
Biochemical and functional characterization of Mycobacterium tuberculosis ketol-acid reductoisomerase. doi:10.1099/mic.0.001087 2021
Proteomic profile of Mycobacterium tuberculosis after eupomatenoid-5 induction reveals potential drug targets. doi:10.2217/fmb-2017-0023 2017
Cloning and sequencing of the ilvBNC gene cluster from Mycobacterium avium. doi:10.1016/0378-1119(96)00275-2 1996

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index -4.94 (95% CI -6.55 to -3.25). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in valine and isoleucine biosynthesis (at the second step) [catalytic activity: (R)-2,3-dihydroxy-3-methylbutanoate + NADP(+) = (S)-2-hydroxy-2-methyl-3-oxobutanoate + NADPH].
Mycobrowser EC 1.1.1.86 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3026c · 100.0% identity
M. leprae ML1694c · 86.2% identity
M. marinum MMAR_1712 · 90.4% identity
M. smegmatis MSMEG_2374 · 84.4% identity
M. orygis RJtmp_003099 · 100.0% identity
M. abscessus MAB_3321c · 85.3% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WKJ7 SwissProt · reviewed · Evidence at protein level
UniProt nameKetol-acid reductoisomerase
EC (curated) EC 1.1.1.86
Curated functionInvolved in the biosynthesis of branched-chain amino acids (BCAA). Catalyzes an alkyl-migration followed by a ketol-acid reduction of (S)-2-acetolactate (S2AL) to yield (R)-2,3-dihydroxy-isovalerate. In the isomerase reaction, S2AL is rearranged via a Mg-dependent methyl migration to produce 3-hydroxy-3-methyl-2-ketobutyrate (HMKB). In the reductase reaction, this 2-ketoacid undergoes a metal-dependent reduction by NADPH to yield (R)-2,3-dihydroxy-isovalerate. It is also able to use 3-hydroxypyruvate (HP).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
H Coenzyme transport and metabolism
Preferred nameilvC
eggNOG descriptionInvolved in the biosynthesis of branched-chain amino acids (BCAA). Catalyzes an alkyl-migration followed by a ketol- acid reduction of (S)-2-acetolactate (S2AL) to yield (R)-2,3- dihydroxy-isovalerate. In the isomerase reaction, S2AL is rearranged via a Mg-dependent methyl migration to produce 3- hydroxy-3-methyl-2-ketobutyrate (HMKB). In the reductase reaction, this 2-ketoacid undergoes a metal-dependent reduction by NADPH to yield (R)-2,3-dihydroxy-isovalerate
Orthologous groupCOG0059
EC number EC 1.1.1.86
KEGG orthology K00053
KEGG pathways map00290, map00770, map01100, map01110, map01130, map01210, map01230
KEGG modules M00019, M00570
Gene Ontology (21) GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0008150, GO:0008152, GO:0008677, GO:0016020 +9 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 88.7% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 68.7%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) essential

DeJesus 2017 callES · essential
What the call meansessential: insertions absent across the whole ORF
TA sites (Himar1) 14 in the ORF — 13 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.071, mean read count 107. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain

This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.

Hypomorph strainilvC-TetOn 10.1 (TetON promoter 10)
Baseline knockdown fitness4.783 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown
Used in target deconvolutionyes (informs phenotypic-cluster / MOA assignment)

Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.

Proteomics (mass spectrometry) detected

MS detectiondetected in 16 of 16 independent MS datasets
Integrated abundance1700.0 ppm · rank 116/3519 (96.7th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length333 aa
Molecular weight36.1 kDa
Theoretical pI5.03
GRAVY-0.144 (hydrophilic)
Aliphatic index92.2
Aromaticity0.069
Instability index33.5 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
KARI_NPF07991.19 2.1e-6912–175 Acetohydroxy acid isomeroreductase, NADPH-binding domain
2-Hacid_dh_CPF02826.26 1.1e-0612–84 D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
NAD_binding_2PF03446.22 5.0e-0516–101 NAD binding domain of 6-phosphogluconate dehydrogenase
KARI_CPF01450.26 1.8e-58181–324 Ketol-acid reductoisomerase, C-terminal domain

Experimental structures (Protein Data Bank) 1 solved

PDBMethodResolutionCoverage
4ypo X-ray diffraction 1.001 Å 99%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.1

PDB hitprobTM-scoreE-valueDescription
4ypo-assembly1_B 1.00 0.97 5.2e-56 sig 4ypo-assembly1_B Crystal structure of Mycobacterium tuberculosis ketol-acid reductoisomerase in complex with Mg2+
6jx2-assembly2_C 1.00 0.98 4.9e-47 sig 6jx2-assembly2_C Crystal structure of Ketol-acid reductoisomerase from Corynebacterium glutamicum
4kqw-assembly1_B 1.00 0.98 1.3e-42 sig 4kqw-assembly1_B The structure of the Slackia exigua KARI in complex with NADP
6aqj-assembly1_A 1.00 0.97 2.4e-42 sig 6aqj-assembly1_A Crystal structures of Staphylococcus aureus ketol-acid reductoisomerase in complex with two transition state analogs that have biocidal activity.
1np3-assembly1_A 1.00 0.96 6.1e-42 sig 1np3-assembly1_A Crystal structure of class I acetohydroxy acid isomeroreductase from Pseudomonas aeruginosa

Foldseek search of the AlphaFold DB model (mean pLDDT 96.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 3

Upstream (5' on genome)Rv3000 (+ strand, 313 bp gap)
Downstream (3' on genome)ilvN (- strand, 37 bp gap)
Predicted operon ilvC · ilvN · ilvB1

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: ilvN (acetolactate synthase small subunit), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3002c ilvN exp acetolactate synthase small subunit 999 1000 ctx neighborhood:823 cooccurence:719 coexpression:951 database:900 textmining:938
Rv3003c ilvB1 exp acetolactate synthase large subunit IlvB 999 997 ctx neighborhood:732 cooccurence:766 coexpression:618 database:900 textmining:813
Rv0189c ilvD exp dihydroxy-acid dehydratase 998 995 ctx cooccurence:733 coexpression:791 database:900 textmining:802
Rv3470c ilvB2 exp acetolactate synthase large subunit 988 987 ctx cooccurence:735 coexpression:537 database:900
Rv1820 ilvG exp acetolactate synthase large subunit IlvG 991 975 ctx cooccurence:463 coexpression:540 database:900 textmining:670
Rv3509c ilvX exp acetohydroxyacid synthase large subunit 980 964 coexpression:540 database:900 textmining:479
Rv2987c leuD 3-isopropylmalate dehydratase small subunit 970 905 coexpression:848 textmining:707
Rv2995c leuB 3-isopropylmalate dehydrogenase 972 904 coexpression:837 textmining:725
Rv2988c leuC 3-isopropylmalate dehydratase large subunit 958 903 coexpression:852 textmining:588
Rv3710 leuA 2-isopropylmalate synthase 937 777 coexpression:699 textmining:731
Rv3469c mhpE 4-hydroxy-2-oxovalerate aldolase MhpE 765 740 coexpression:691
Rv1295 thrC threonine synthase 795 712 coexpression:636
Rv3534c hsaF 4-hydroxy-2-oxovalerate aldolase 733 704 coexpression:693
Rv1559 ilvA threonine dehydratase IlvA 900 699 coexpression:526 textmining:682
Rv0118c oxcA oxalyl-CoA decarboxylase OxcA 775 691 coexpression:538

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ketol-acid reductoisomerase
  • MTBC0 PGAP product: ketol-acid reductoisomerase
  • Pfam (hmmscan --cut_ga): KARI_N PF07991.19 (E=2e-69), 2-Hacid_dh_C PF02826.26 (E=1e-06), NAD_binding_2 PF03446.22 (E=5e-05), KARI_C PF01450.26 (E=2e-58)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217517.3)
  • Domains: Pfam-A via hmmscan --cut_ga — KARI_N (PF07991.19), 2-Hacid_dh_C (PF02826.26), NAD_binding_2 (PF03446.22), KARI_C (PF01450.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0059
  • Curated reference: UniProt P9WKJ7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.1)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 79 functional partner(s); context anchor ilvN
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003190|Rv3001c|ilvC
MFYDDDADLSIIQGRKVGVIGYGSQGHAHSLSLRDSGVQVRVGLKQGSRSRPKVEEQGLDVDTPAEVAKWADVVMVLAPDTAQAEIFAGDIEPNLKPGDALFFGHGLNVHFGLIKPPADVAVAMVAPKGPGHLVRRQFVDGKGVPCLVAVEQDPRGDGLALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQTVLCGGTEELVKAGFEVMVEAGYPAELAYFEVLHELKLIVDLMYEGGLARMYYSVSDTAEFGGYLSGPRVIDAGTKERMRDILREIQDGSFVHKLVADVEGGNKQLEELRRQNAEHPIEVVGKKLRDLMSWVDRPITETA