ilvC Resolved · high auto-curated
H37Rv Rv3001c · MTBC0 mtbc0_003190 ·
333 aa ·
3380894–3381895 MTBC0
(-) ·
RefSeq NP_217517.3
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ketol-acid reductoisomerase |
|---|---|
| MTBC0 PGAP re-annotation | ketol-acid reductoisomerase |
| Revised (this work) | Ketol-acid reductoisomerase. Pfam: KARI_N (PF07991.19), 2-Hacid_dh_C (PF02826.26), NAD_binding_2 (PF03446.22), KARI_C (PF01450.26). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 4 publications
4 TB publications mention this gene. 4 publication(s) discuss this gene (3 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| A d-Phenylalanine-Benzoxazole Derivative Reveals the Role of the Essential Enzyme Rv3603c in the Pantothenate Biosynthetic Pathway of Mycobacterium tuberculosis. doi:10.1021/acsinfecdis.1c00461 | 2022 |
| Biochemical and functional characterization of Mycobacterium tuberculosis ketol-acid reductoisomerase. doi:10.1099/mic.0.001087 | 2021 |
| Proteomic profile of Mycobacterium tuberculosis after eupomatenoid-5 induction reveals potential drug targets. doi:10.2217/fmb-2017-0023 | 2017 |
| Cloning and sequencing of the ilvBNC gene cluster from Mycobacterium avium. doi:10.1016/0378-1119(96)00275-2 | 1996 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -4.94 (95% CI -6.55 to -3.25). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in valine and isoleucine biosynthesis (at the second step) [catalytic activity: (R)-2,3-dihydroxy-3-methylbutanoate + NADP(+) = (S)-2-hydroxy-2-methyl-3-oxobutanoate + NADPH]. |
|---|---|
| Mycobrowser EC |
1.1.1.86
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3026c
· 100.0% identity |
|---|---|
| M. leprae |
ML1694c
· 86.2% identity |
| M. marinum |
MMAR_1712
· 90.4% identity |
| M. smegmatis |
MSMEG_2374
· 84.4% identity |
| M. orygis |
RJtmp_003099
· 100.0% identity |
| M. abscessus |
MAB_3321c
· 85.3% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WKJ7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Ketol-acid reductoisomerase |
| EC (curated) |
EC 1.1.1.86
|
| Curated function | Involved in the biosynthesis of branched-chain amino acids (BCAA). Catalyzes an alkyl-migration followed by a ketol-acid reduction of (S)-2-acetolactate (S2AL) to yield (R)-2,3-dihydroxy-isovalerate. In the isomerase reaction, S2AL is rearranged via a Mg-dependent methyl migration to produce 3-hydroxy-3-methyl-2-ketobutyrate (HMKB). In the reductase reaction, this 2-ketoacid undergoes a metal-dependent reduction by NADPH to yield (R)-2,3-dihydroxy-isovalerate. It is also able to use 3-hydroxypyruvate (HP). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolismH Coenzyme transport and metabolism
|
|---|---|
| Preferred name | ilvC |
| eggNOG description | Involved in the biosynthesis of branched-chain amino acids (BCAA). Catalyzes an alkyl-migration followed by a ketol- acid reduction of (S)-2-acetolactate (S2AL) to yield (R)-2,3- dihydroxy-isovalerate. In the isomerase reaction, S2AL is rearranged via a Mg-dependent methyl migration to produce 3- hydroxy-3-methyl-2-ketobutyrate (HMKB). In the reductase reaction, this 2-ketoacid undergoes a metal-dependent reduction by NADPH to yield (R)-2,3-dihydroxy-isovalerate |
| Orthologous group | COG0059 |
| EC number |
EC 1.1.1.86
|
| KEGG orthology |
K00053
|
| KEGG pathways |
map00290, map00770, map01100, map01110, map01130, map01210, map01230
|
| KEGG modules |
M00019, M00570
|
| Gene Ontology (21) |
GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0008150, GO:0008152, GO:0008677, GO:0016020 +9 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 88.7%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 68.7% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 14 in the ORF — 13 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.071, mean read count 107. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | ilvC-TetOn 10.1 (TetON promoter 10) |
|---|---|
| Baseline knockdown fitness | 4.783 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 16 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 1700.0 ppm · rank 116/3519 (96.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 333 aa |
|---|---|
| Molecular weight | 36.1 kDa |
| Theoretical pI | 5.03 |
| GRAVY | -0.144 (hydrophilic) |
| Aliphatic index | 92.2 |
| Aromaticity | 0.069 |
| Instability index | 33.5 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
KARI_N | PF07991.19 | 2.1e-69 | 12–175 | Acetohydroxy acid isomeroreductase, NADPH-binding domain |
2-Hacid_dh_C | PF02826.26 | 1.1e-06 | 12–84 | D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain |
NAD_binding_2 | PF03446.22 | 5.0e-05 | 16–101 | NAD binding domain of 6-phosphogluconate dehydrogenase |
KARI_C | PF01450.26 | 1.8e-58 | 181–324 | Ketol-acid reductoisomerase, C-terminal domain |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
4ypo |
X-ray diffraction | 1.001 Å | 99% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4ypo-assembly1_B |
1.00 | 0.97 | 5.2e-56 sig | 4ypo-assembly1_B Crystal structure of Mycobacterium tuberculosis ketol-acid reductoisomerase in complex with Mg2+ |
6jx2-assembly2_C |
1.00 | 0.98 | 4.9e-47 sig | 6jx2-assembly2_C Crystal structure of Ketol-acid reductoisomerase from Corynebacterium glutamicum |
4kqw-assembly1_B |
1.00 | 0.98 | 1.3e-42 sig | 4kqw-assembly1_B The structure of the Slackia exigua KARI in complex with NADP |
6aqj-assembly1_A |
1.00 | 0.97 | 2.4e-42 sig | 6aqj-assembly1_A Crystal structures of Staphylococcus aureus ketol-acid reductoisomerase in complex with two transition state analogs that have biocidal activity. |
1np3-assembly1_A |
1.00 | 0.96 | 6.1e-42 sig | 1np3-assembly1_A Crystal structure of class I acetohydroxy acid isomeroreductase from Pseudomonas aeruginosa |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | Rv3000 (+ strand, 313 bp gap) |
|---|---|
| Downstream (3' on genome) | ilvN (- strand, 37 bp gap) |
| Predicted operon |
ilvC · ilvN · ilvB1
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: ilvN (acetolactate synthase small subunit), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3002c ilvN exp |
acetolactate synthase small subunit | 999 | 1000 ctx | neighborhood:823 cooccurence:719 coexpression:951 database:900 textmining:938 |
Rv3003c ilvB1 exp |
acetolactate synthase large subunit IlvB | 999 | 997 ctx | neighborhood:732 cooccurence:766 coexpression:618 database:900 textmining:813 |
Rv0189c ilvD exp |
dihydroxy-acid dehydratase | 998 | 995 ctx | cooccurence:733 coexpression:791 database:900 textmining:802 |
Rv3470c ilvB2 exp |
acetolactate synthase large subunit | 988 | 987 ctx | cooccurence:735 coexpression:537 database:900 |
Rv1820 ilvG exp |
acetolactate synthase large subunit IlvG | 991 | 975 ctx | cooccurence:463 coexpression:540 database:900 textmining:670 |
Rv3509c ilvX exp |
acetohydroxyacid synthase large subunit | 980 | 964 | coexpression:540 database:900 textmining:479 |
Rv2987c leuD |
3-isopropylmalate dehydratase small subunit | 970 | 905 | coexpression:848 textmining:707 |
Rv2995c leuB |
3-isopropylmalate dehydrogenase | 972 | 904 | coexpression:837 textmining:725 |
Rv2988c leuC |
3-isopropylmalate dehydratase large subunit | 958 | 903 | coexpression:852 textmining:588 |
Rv3710 leuA |
2-isopropylmalate synthase | 937 | 777 | coexpression:699 textmining:731 |
Rv3469c mhpE |
4-hydroxy-2-oxovalerate aldolase MhpE | 765 | 740 | coexpression:691 |
Rv1295 thrC |
threonine synthase | 795 | 712 | coexpression:636 |
Rv3534c hsaF |
4-hydroxy-2-oxovalerate aldolase | 733 | 704 | coexpression:693 |
Rv1559 ilvA |
threonine dehydratase IlvA | 900 | 699 | coexpression:526 textmining:682 |
Rv0118c oxcA |
oxalyl-CoA decarboxylase OxcA | 775 | 691 | coexpression:538 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ketol-acid reductoisomerase
- MTBC0 PGAP product: ketol-acid reductoisomerase
- Pfam (hmmscan --cut_ga): KARI_N PF07991.19 (E=2e-69), 2-Hacid_dh_C PF02826.26 (E=1e-06), NAD_binding_2 PF03446.22 (E=5e-05), KARI_C PF01450.26 (E=2e-58)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217517.3)
- Domains: Pfam-A via hmmscan --cut_ga — KARI_N (PF07991.19), 2-Hacid_dh_C (PF02826.26), NAD_binding_2 (PF03446.22), KARI_C (PF01450.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0059 - Curated reference: UniProt P9WKJ7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
79 functional partner(s); context anchor
ilvN - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003190|Rv3001c|ilvC MFYDDDADLSIIQGRKVGVIGYGSQGHAHSLSLRDSGVQVRVGLKQGSRSRPKVEEQGLDVDTPAEVAKWADVVMVLAPDTAQAEIFAGDIEPNLKPGDALFFGHGLNVHFGLIKPPADVAVAMVAPKGPGHLVRRQFVDGKGVPCLVAVEQDPRGDGLALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQTVLCGGTEELVKAGFEVMVEAGYPAELAYFEVLHELKLIVDLMYEGGLARMYYSVSDTAEFGGYLSGPRVIDAGTKERMRDILREIQDGSFVHKLVADVEGGNKQLEELRRQNAEHPIEVVGKKLRDLMSWVDRPITETA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for ilvC? Email the maintainer — the message is pre-filled with this gene's details.