Rv0569 Family assigned · medium
H37Rv Rv0569 · MTBC0 mtbc0_000599 ·
88 aa ·
664554–664820 MTBC0
(+) ·
RefSeq NP_215083.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF1918 domain-containing protein |
| Revised (this work) | DosR (dormancy survival regulon) protein; conserved hypothetical protein over-expressed under hypoxia. NMR solution structure determined (five antiparallel beta-sheets + one alpha-helix), structurally homologous to Rv2302; proposed to contribute to hypoxic signal transduction by binding DNA to up-regulate the adjacent Rv0570. Immunodominant Th1 latency antigen. Precise molecular function unfixed. |
| Functional category (TubercuList) | conserved hypotheticals |
In the literature (TB corpus sweep) 9 publications
Found under: H37Rv (9).
9 TB publications mention this gene. 9 publication(s) mention this gene (title/abstract), verified against the text. The atlas states the function; these are the primary sources that discuss it.
| Publication | Date |
|---|---|
| Multifaceted DosR proteins of Mycobacterium tuberculosis: emerging roles for tuberculosis control. doi:10.1007/s00203-026-04983-7 | 2026 |
| Role of dormancy survival regulator and resuscitation-promoting factors antigens in differentiating between active and latent tuberculosis: a systematic review and meta-analysis. doi:10.1186/s12890-024-03348-4 | 2024 |
| Immunogenic profiling of Mycobacterium tuberculosis DosR protein Rv0569 reveals its ability to switch on Th1 based immunity. doi:10.1016/j.imlet.2022.01.001 | 2022 |
| Solution structure of Rv0569, potent hypoxic signal transduction protein, from Mycobacterium tuberculosis. doi:10.1016/j.tube.2013.08.008 | 2014 |
| Analysis of host responses to Mycobacterium tuberculosis antigens in a multi-site study of subjects with different TB and HIV infection states in sub-Saharan Africa. doi:10.1371/journal.pone.0074080 | 2013 |
This layer CITES the literature, it does not change the verdict or the function. A gene may be heavily studied (as an antigen, a resistance determinant, a drug target) while its molecular function is settled elsewhere in the fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
Phenotype-driven functional lead (hypothesis) priority 6.4
required for fitness in vivo (virulence / persistence factor); disruption advantageous under acid stress in phosphate-citrate buffer.
| Corroborating evidence | conserved / under constraint intra-MTBC; STRING-coupled to nrdZ (vitamin B12-dependent ribonucleoside-diphosphate reductase); in the DosR dormancy regulon; co-transcribed with nrdZ; structural lead available |
|---|
This locus is a "hypothetical" with a conditional Tn-seq phenotype. The statement above is a working hypothesis for its functional context, synthesised from the phenotype pattern and the corroborating layers on this page (conservation, STRING coupling, operon, regulon, localisation, structure) — a prioritised requalification candidate to validate, not an established function.
Conditional expression context (iModulons)
Member of 2 independently-modulated gene set(s):
DevR-1 (devR), DevR-2 (devR).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.02 (95% CI -1.82 to 2.97). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser) ahead of Mycobrowser
| Mycobrowser function | Function unknown |
|---|
Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (COG category). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0584
· 100.0% identity |
|---|---|
| M. orygis |
RJtmp_000598
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WM83
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv0569 |
UniProt still lists this protein as Uncharacterized protein Rv0569; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
T Signal transduction mechanisms
|
|---|---|
| eggNOG description | Domain of unknown function (DUF1918) |
| Orthologous group | COG2905 |
| Gene Ontology (18) |
GO:0001666, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006950, GO:0008150, GO:0009628, GO:0030312, GO:0036293 +6 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 29/53 (55%) · mean identity 71.6%
· 4/4 closest MTBAP relatives conserved across the genus (present in 29/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 1/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 38.0% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 4 in the ORF — 0 in the essential state, 0 growth-defect, 4 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 216.5. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Statistically thin call: only 4 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| altered fitness under acid stress in phosphate-citrate buffer (stress) | +2.01 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | -1.44 | 0.0016 | required |
Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 1299.0 ppm · rank 168/3519 (95.3th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 88 aa |
|---|---|
| Molecular weight | 9.5 kDa |
| Theoretical pI | 5.7 |
| GRAVY | -0.212 (hydrophilic) |
| Aliphatic index | 93.1 |
| Aromaticity | 0.045 |
| Instability index | 41.2 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF1918 | PF08940.18 | 1.3e-26 | 1–58 | Domain of unknown function (DUF1918) |
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 64.3 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
2a7y-assembly1_A |
1.00 | 0.67 | 3.3e-05 sig | 2a7y-assembly1_A Solution Structure of the Conserved Hypothetical Protein Rv2302 from the Bacterium Mycobacterium tuberculosis |
7hg5-assembly3_C |
0.82 | 0.49 | 1.5e-01 | 7hg5-assembly3_C PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z2142244288 |
5znp-assembly2_B |
0.72 | 0.57 | 2.3e-01 | 5znp-assembly2_B Crystal structure of PtSHL in complex with an H3K4me3 peptide |
5znr-assembly2_B |
0.69 | 0.65 | 5.5e-01 | 5znr-assembly2_B Crystal structure of PtSHL in complex with an H3K27me3 peptide |
2f5k-assembly6_F |
0.66 | 0.44 | 3.4e-01 | 2f5k-assembly6_F Crystal structure of the chromo domain of human MRG15 |
6bph-assembly1_A-2 |
0.57 | 0.52 | 5.5e-01 | 6bph-assembly1_A-2 Crystal structure of the chromodomain of RBBP1 |
7hh4-assembly2_B |
0.51 | 0.49 | 5.9e-01 | 7hh4-assembly2_B PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1139246057 |
6bhe-assembly1_A |
0.47 | 0.53 | 1.0e+00 | 6bhe-assembly1_A Crystal structure of SETDB1 with a modified H3 peptide |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 74.7
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2a7y-assembly1_A |
1.00 | 0.57 | 4.4e-05 sig | 2a7y-assembly1_A Solution Structure of the Conserved Hypothetical Protein Rv2302 from the Bacterium Mycobacterium tuberculosis |
Foldseek search of the AlphaFold DB model (mean pLDDT 74.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | cyp135B1 (+ strand, 134 bp gap) |
|---|---|
| Downstream (3' on genome) | nrdZ (+ strand, 25 bp gap) |
| Predicted operon |
Rv0569 · nrdZ
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
devR (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: nrdZ (vitamin B12-dependent ribonucleoside-diphosphate reductase), high confidence from genomic context alone (score 822 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3132c devS |
two component sensor histidine kinase DevS | 904 | 870 | coexpression:803 |
Rv3133c devR |
two component transcriptional regulator DevR | 900 | 832 | coexpression:810 textmining:433 |
Rv0570 nrdZ |
vitamin B12-dependent ribonucleoside-diphosphate reductase | 822 | 822 ctx | neighborhood:724 |
Rv2005c |
universal stress protein | 819 | 819 | coexpression:774 |
Rv1736c narX |
nitrate reductase-like protein NarX | 615 | 615 | coexpression:615 |
Rv0568 cyp135B1 |
cytochrome P450 Cyp135B1 | 528 | 527 ctx | neighborhood:521 |
Rv2557 hyp |
hypothetical protein | 496 | 496 ctx | cooccurence:462 |
Rv3134c |
universal stress protein | 577 | 488 ctx | cooccurence:406 |
Rv2028c |
universal stress protein | 501 | 488 | |
Rv2624c |
universal stress protein | 481 | 481 | |
Rv2558 hyp |
hypothetical protein | 479 | 480 ctx | cooccurence:445 |
Rv1888c |
Rv1888c, (MTCY180.30), len: 186 aa. Possible transmembrane protein. | 473 | 474 ctx | cooccurence:466 |
Rv1738 hyp |
hypothetical protein | 795 | 470 ctx | cooccurence:462 textmining:630 |
Rv1907c hyp |
hypothetical protein | 457 | 457 ctx | cooccurence:451 |
Rv0080 hyp |
hypothetical protein | 447 | 448 ctx | cooccurence:436 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- NMR solution structure; structural homolog of Rv2302 (Kim 2014, PMID 24275361)
- DosR regulon; immunodominant Th1-switching latency antigen (Kanaparthi 2022, PMID 35007662)
- Pfam DUF1918
- Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215083.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF1918 (PF08940.18)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2905 - Curated reference: UniProt P9WM83 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 64.3, low)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 74.7)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
39 functional partner(s); context anchor
nrdZ - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: Kim WJ, Son WS, Ahn DH, Im H, Ahn HC, Lee BJ (2014). Solution structure of Rv0569, potent hypoxic signal transduction protein, from Mycobacterium tuberculosis Tuberculosis (Edinb) 94(1):43-50. doi:10.1016/j.tube.2013.08.008 PMID:24275361
- Primary literature: Kanaparthi KJ, Afroz S, Minhas G, Moitra A, Khan RA, Medikonda J, Naz S, Cholleti SN, Banerjee S, Khan N (2022). Immunogenic profiling of Mycobacterium tuberculosis DosR protein Rv0569 reveals its ability to switch on Th1 based immunity Immunol Lett 242:27-36. doi:10.1016/j.imlet.2022.01.001 PMID:35007662
Ancestral MTBC0 protein sequence
>mtbc0_000599|Rv0569| MKAKVGDWLVIKGATIDQPDHRGLIIEVRSSDGSPPYVVRWLETDHVATVIPGPDAVVVTAEEQNAADERAQHRFGAVQSAILHARGT
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv0569? Email the maintainer — the message is pre-filled with this gene's details.