Rv0569 Family assigned · medium

H37Rv Rv0569 · MTBC0 mtbc0_000599 · 88 aa · 664554–664820 (+) · RefSeq NP_215083.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF1918 domain-containing protein
Revised (this work)DosR (dormancy survival regulon) protein; conserved hypothetical protein over-expressed under hypoxia. NMR solution structure determined (five antiparallel beta-sheets + one alpha-helix), structurally homologous to Rv2302; proposed to contribute to hypoxic signal transduction by binding DNA to up-regulate the adjacent Rv0570. Immunodominant Th1 latency antigen. Precise molecular function unfixed.

Curated reference (UniProt)

UniProt P9WM83 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv0569

UniProt still lists this protein as Uncharacterized protein Rv0569; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
eggNOG descriptionDomain of unknown function (DUF1918)
Orthologous groupCOG2905
Gene Ontology (18) GO:0001666, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006950, GO:0008150, GO:0009628, GO:0030312, GO:0036293 +6 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF1918PF08940.18 1.3e-261–58 Domain of unknown function (DUF1918)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 64.3 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
2a7y-assembly1_A 1.00 0.67 3.3e-05 sig 2a7y-assembly1_A Solution Structure of the Conserved Hypothetical Protein Rv2302 from the Bacterium Mycobacterium tuberculosis
7hg5-assembly3_C 0.82 0.49 1.5e-01 7hg5-assembly3_C PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z2142244288
5znp-assembly2_B 0.72 0.57 2.3e-01 5znp-assembly2_B Crystal structure of PtSHL in complex with an H3K4me3 peptide
5znr-assembly2_B 0.69 0.65 5.5e-01 5znr-assembly2_B Crystal structure of PtSHL in complex with an H3K27me3 peptide
2f5k-assembly6_F 0.66 0.44 3.4e-01 2f5k-assembly6_F Crystal structure of the chromo domain of human MRG15
6bph-assembly1_A-2 0.57 0.52 5.5e-01 6bph-assembly1_A-2 Crystal structure of the chromodomain of RBBP1
7hh4-assembly2_B 0.51 0.49 5.9e-01 7hh4-assembly2_B PanDDA analysis group deposition -- Crystal structure of HRP-2 PWWP domain in complex with Z1139246057
6bhe-assembly1_A 0.47 0.53 1.0e+00 6bhe-assembly1_A Crystal structure of SETDB1 with a modified H3 peptide

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: nrdZ (vitamin B12-dependent ribonucleoside-diphosphate reductase), high confidence from genomic context alone (score 822 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3132c devS two component sensor histidine kinase DevS 904 870 coexpression:803
Rv3133c devR two component transcriptional regulator DevR 900 832 coexpression:810 textmining:433
Rv0570 nrdZ vitamin B12-dependent ribonucleoside-diphosphate reductase 822 822 ctx neighborhood:724
Rv2005c universal stress protein 819 819 coexpression:774
Rv1736c narX nitrate reductase-like protein NarX 615 615 coexpression:615
Rv0568 cyp135B1 cytochrome P450 Cyp135B1 528 527 ctx neighborhood:521
Rv2557 hyp hypothetical protein 496 496 ctx cooccurence:462
Rv3134c universal stress protein 577 488 ctx cooccurence:406
Rv2028c universal stress protein 501 488
Rv2624c universal stress protein 481 481
Rv2558 hyp hypothetical protein 479 480 ctx cooccurence:445
Rv1888c Rv1888c, (MTCY180.30), len: 186 aa. Possible transmembrane protein. 473 474 ctx cooccurence:466
Rv1738 hyp hypothetical protein 795 470 ctx cooccurence:462 textmining:630
Rv1907c hyp hypothetical protein 457 457 ctx cooccurence:451
Rv0080 hyp hypothetical protein 447 448 ctx cooccurence:436

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • NMR solution structure; structural homolog of Rv2302 (Kim 2014, PMID 24275361)
  • DosR regulon; immunodominant Th1-switching latency antigen (Kanaparthi 2022, PMID 35007662)
  • Pfam DUF1918
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215083.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF1918 (PF08940.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2905
  • Curated reference: UniProt P9WM83 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 64.3, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 39 functional partner(s); context anchor nrdZ
  • Primary literature: Kim WJ, Son WS, Ahn DH, Im H, Ahn HC, Lee BJ (2014). Solution structure of Rv0569, potent hypoxic signal transduction protein, from Mycobacterium tuberculosis Tuberculosis (Edinb) 94(1):43-50. doi:10.1016/j.tube.2013.08.008 PMID:24275361
  • Primary literature: Kanaparthi KJ, Afroz S, Minhas G, Moitra A, Khan RA, Medikonda J, Naz S, Cholleti SN, Banerjee S, Khan N (2022). Immunogenic profiling of Mycobacterium tuberculosis DosR protein Rv0569 reveals its ability to switch on Th1 based immunity Immunol Lett 242:27-36. doi:10.1016/j.imlet.2022.01.001 PMID:35007662

Ancestral MTBC0 protein sequence

>mtbc0_000599|Rv0569|
MKAKVGDWLVIKGATIDQPDHRGLIIEVRSSDGSPPYVVRWLETDHVATVIPGPDAVVVTAEEQNAADERAQHRFGAVQSAILHARGT