Rv2466c Family assigned · medium auto-curated

H37Rv Rv2466c · MTBC0 mtbc0_002627 · 207 aa · 2792509–2793132 (-) · RefSeq NP_216982.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationRv2466c family mycothiol-dependent reductase
Revised (this work)Rv2466c family mycothiol-dependent reductase. Pfam: DSBA (PF01323.27), Rv2466c-like (PF22234.3).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53193 SwissProt · reviewed · Evidence at protein level
UniProt nameThioredoxin-like reductase Rv2466c
Curated functionIn vitro, the reduced form of Rv2466c catalyzes the reduction and activation of TP053, which is a thienopyrimidine derivative drug that can kill both replicating and non-replicating M.tuberculosis.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
eggNOG descriptionDSBA-like thioredoxin domain
Orthologous groupCOG2761
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.14% of strains (205) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DSBAPF01323.27 1.2e-1112–165 DSBA-like thioredoxin domain
Rv2466c-likePF22234.3 1.4e-9218–198 Mycothiol-dependent nitroreductase Rv2466c

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpiB (ribose-5-phosphate isomerase B), high confidence from genomic context alone (score 818 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2465c rpiB ribose-5-phosphate isomerase B 817 818 ctx neighborhood:773
Rv3463 hyp hypothetical protein 806 807 coexpression:806
Rv2464c nei1 DNA glycosylase 801 802 ctx neighborhood:773
Rv0819 mshD mycothiol acetyltransferase 798 799 ctx cooccurence:769
Rv1082 mca mycothiol S-conjugate amidase 789 789 ctx cooccurence:773
Rv1170 mshB 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase 752 752 ctx cooccurence:740
Rv3054c hyp hypothetical protein 745 745 coexpression:729
Rv0360c hyp hypothetical protein 747 738 ctx cooccurence:738
Rv2130c mshC cysteine:1D-myo-inosityl 2-amino-2-deoxy--D-glucopyranoside ligase 694 683 ctx cooccurence:666
Rv2467 pepN aminopeptidase PepN 638 638 ctx neighborhood:633
Rv0486 mshA D-inositol 3-phosphate glycosyltransferase 628 552 ctx cooccurence:552
Rv2470 glbO hemoglobin GlbO 576 533 coexpression:419
Rv0443 hyp hypothetical protein 525 525 ctx cooccurence:521
Rv0323c hyp hypothetical protein 467 467 ctx cooccurence:440
Rv2389c rpfD resuscitation-promoting factor RpfD 466 466 ctx cooccurence:466

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: Rv2466c family mycothiol-dependent reductase
  • Pfam (hmmscan --cut_ga): DSBA PF01323.27 (E=1e-11), Rv2466c-like PF22234.3 (E=1e-92)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216982.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DSBA (PF01323.27), Rv2466c-like (PF22234.3)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2761
  • Curated reference: UniProt O53193 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 48 functional partner(s); context anchor rpiB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002627|Rv2466c|
MLEKAPQKSVADFWFDPLCPWCWITSRWILEVAKVRDIEVNFHVMSLAILNENRDDLPEQYREGMARAWGPVRVAIAAEQAHGAKVLDPLYTAMGNRIHNQGNHELDEVITQSLADAGLPAELAKAATSDAYDNALRKSHHAGMDAVGEDVGTPTIHVNGVAFFGPVLSKIPRGEEAGKLWDASVTFASYPHFFELKRTRTEPPQFD