Rv0110 Family assigned · medium auto-curated

H37Rv Rv0110 · MTBC0 - · 249 aa · 133020–133769 (+) · RefSeq NP_214624.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)integral membrane protein
MTBC0 PGAP re-annotation
Revised (this work)Integral membrane protein. Pfam: Rhomboid (PF01694.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O53632 TrEMBL · unreviewed · Inferred from homology
UniProt nameProbable conserved integral membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category N Cell motility
U Intracellular trafficking, secretion and vesicular transport
Preferred namegluP
eggNOG descriptionRhomboid family
Orthologous groupCOG0705
EC number EC 3.4.21.105
KEGG orthology K19225

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.375 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.19% of strains (274) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RhomboidPF01694.29 2.7e-3474–205 Rhomboid domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PE_PGRS1 (PE-PGRS family protein PE_PGRS1), medium confidence from genomic context alone (score 505 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1488 hyp hypothetical protein 698 672 database:619
Rv3090 hyp hypothetical protein 697 670 database:619
Rv0108c hyp hypothetical protein 619 620 ctx neighborhood:618
Rv3610c ftsH zinc metalloprotease FtsH 650 604 database:596
Rv0992c 5-formyltetrahydrofolate cyclo-ligase 523 523 coexpression:496
Rv0109 PE_PGRS1 PE-PGRS family protein PE_PGRS1 506 505 ctx neighborhood:505
Rv3717 hyp hypothetical protein 499 500 experimental:465
Rv3915 cwlM peptidoglycan hydrolase 495 495 experimental:465
Rv2094c tatA Sec-independent protein translocase membrane-bound protein TatA 575 469 experimental:467
Rv1224 tatB Sec-independent protein translocase protein TatB 511 468 experimental:467
Rv0111 acyltransferase 930 465 ctx neighborhood:460 textmining:875
Rv3365c hyp hypothetical protein 475 452
Rv2553c mltG membrane protein 434 435 coexpression:410
Rv1338 murI glutamate racemase 673 103 textmining:651
Rv0274 hyp hypothetical protein 875 79 textmining:870

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): integral membrane protein
  • Pfam (hmmscan --cut_ga): Rhomboid PF01694.29 (E=3e-34)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214624.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rhomboid (PF01694.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0705
  • Curated reference: UniProt O53632 (TrEMBL, unreviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor PE_PGRS1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0110|
MRVGPVGHQCAECVREGARAVRQPRTPFGGRQRSATPVVTYTLISLNALVFVMQVTVMGLERQLALWPPAVASGQTYRLVTSAFLHYGAMHLLLNMWALYVVGPPLEMWLGRLRFGALYAVSALGGSVLVYLIAPLNTATAGASGAVFGLFGATFMVARRLHLDVRWVVALIVINLAFTFLAPAISWQGHVGGLVTGALVAATYVYAPRERRNLIQATVTITVLVAFVVLIGWRTVDLLALFGGRLNLS