Rv0110 Family assigned · medium auto-curated
H37Rv Rv0110 · MTBC0 - ·
249 aa · 133020–133769 (+) ·
RefSeq NP_214624.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | integral membrane protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Integral membrane protein. Pfam: Rhomboid (PF01694.29). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
O53632
TrEMBL · unreviewed
· Inferred from homology
|
|---|---|
| UniProt name | Probable conserved integral membrane protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
N Cell motilityU Intracellular trafficking, secretion and vesicular transport
|
|---|---|
| Preferred name | gluP |
| eggNOG description | Rhomboid family |
| Orthologous group | COG0705 |
| EC number |
EC 3.4.21.105
|
| KEGG orthology |
K19225
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.375 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 3 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.19% of strains (274) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Rhomboid | PF01694.29 | 2.7e-34 | 74–205 | Rhomboid domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: PE_PGRS1 (PE-PGRS family protein PE_PGRS1), medium confidence from genomic context alone (score 505 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1488 hyp |
hypothetical protein | 698 | 672 | database:619 |
Rv3090 hyp |
hypothetical protein | 697 | 670 | database:619 |
Rv0108c hyp |
hypothetical protein | 619 | 620 ctx | neighborhood:618 |
Rv3610c ftsH |
zinc metalloprotease FtsH | 650 | 604 | database:596 |
Rv0992c |
5-formyltetrahydrofolate cyclo-ligase | 523 | 523 | coexpression:496 |
Rv0109 PE_PGRS1 |
PE-PGRS family protein PE_PGRS1 | 506 | 505 ctx | neighborhood:505 |
Rv3717 hyp |
hypothetical protein | 499 | 500 | experimental:465 |
Rv3915 cwlM |
peptidoglycan hydrolase | 495 | 495 | experimental:465 |
Rv2094c tatA |
Sec-independent protein translocase membrane-bound protein TatA | 575 | 469 | experimental:467 |
Rv1224 tatB |
Sec-independent protein translocase protein TatB | 511 | 468 | experimental:467 |
Rv0111 |
acyltransferase | 930 | 465 ctx | neighborhood:460 textmining:875 |
Rv3365c hyp |
hypothetical protein | 475 | 452 | |
Rv2553c mltG |
membrane protein | 434 | 435 | coexpression:410 |
Rv1338 murI |
glutamate racemase | 673 | 103 | textmining:651 |
Rv0274 hyp |
hypothetical protein | 875 | 79 | textmining:870 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): integral membrane protein
- Pfam (hmmscan --cut_ga): Rhomboid PF01694.29 (E=3e-34)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214624.1)
- Domains: Pfam-A via hmmscan --cut_ga — Rhomboid (PF01694.29)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0705 - Curated reference: UniProt O53632 (TrEMBL, unreviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
22 functional partner(s); context anchor
PE_PGRS1 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0110| MRVGPVGHQCAECVREGARAVRQPRTPFGGRQRSATPVVTYTLISLNALVFVMQVTVMGLERQLALWPPAVASGQTYRLVTSAFLHYGAMHLLLNMWALYVVGPPLEMWLGRLRFGALYAVSALGGSVLVYLIAPLNTATAGASGAVFGLFGATFMVARRLHLDVRWVVALIVINLAFTFLAPAISWQGHVGGLVTGALVAATYVYAPRERRNLIQATVTITVLVAFVVLIGWRTVDLLALFGGRLNLS