Rv3198A Resolved · high auto-curated

H37Rv Rv3198A · MTBC0 - · 84 aa · 3571335–3571589 (+) · RefSeq YP_177941.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)glutaredoxin protein
MTBC0 PGAP re-annotation
Revised (this work)Glutaredoxin protein. Pfam: Glutaredoxin (PF00462.31).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WN17 SwissProt · reviewed · Evidence at protein level
UniProt namePutative glutaredoxin Rv3198A
EC (curated) EC 1.-.-.-

UniProt still lists this protein as Putative glutaredoxin Rv3198A; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
eggNOG descriptionGlutaredoxin
Orthologous groupCOG0695
EC number EC 1.20.4.3
KEGG orthology K18917

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GlutaredoxinPF00462.31 1.2e-127–60 Glutaredoxin

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: uvrD2 (ATP-dependent DNA helicase UvrD), medium confidence from genomic context alone (score 589 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3051c nrdE ribonucleoside-diphosphate reductase subunit alpha 860 852 database:614
Rv0570 nrdZ vitamin B12-dependent ribonucleoside-diphosphate reductase 859 851 database:614
Rv3198c uvrD2 ATP-dependent DNA helicase UvrD 603 589 ctx neighborhood:587
Rv0835 lpqQ lipoprotein LpqQ 545 545 ctx neighborhood:544
Rv0137c msrA peptide methionine sulfoxide reductase MsrA 904 525 experimental:484 textmining:807
Rv1170 mshB 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase 609 480 ctx cooccurence:477
Rv0486 mshA D-inositol 3-phosphate glycosyltransferase 667 477 ctx cooccurence:477
Rv1307 atpH ATP synthase subunit b/delta 465 465 coexpression:402
Rv3052c nrdI NrdI protein 471 415
Rv1082 mca mycothiol S-conjugate amidase 787 408 ctx cooccurence:407 textmining:656
Rv2466c hyp hypothetical protein 400 326
Rv2855 mtr mycothione reductase 877 256 textmining:842
Rv0794c oxidoreductase 429 215
Rv3221A rshA anti-sigma factor RshA 408 199
Rv2674 msrB peptide methionine sulfoxide reductase MsrB 412 191

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): glutaredoxin protein
  • Pfam (hmmscan --cut_ga): Glutaredoxin PF00462.31 (E=1e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177941.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Glutaredoxin (PF00462.31)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0695
  • Curated reference: UniProt P9WN17 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor uvrD2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3198A|
MITAALTIYTTSWCGYCLRLKTALTANRIAYDEVDIEHNRAAAEFVGSVNGGNRTVPTVKFADGSTLTNPSADEVKAKLVKIAG