Rv3198A Resolved · high auto-curated
H37Rv Rv3198A · MTBC0 - ·
84 aa · 3571335–3571589 (+) ·
RefSeq YP_177941.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | glutaredoxin protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Glutaredoxin protein. Pfam: Glutaredoxin (PF00462.31). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WN17
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative glutaredoxin Rv3198A |
| EC (curated) |
EC 1.-.-.-
|
UniProt still lists this protein as Putative glutaredoxin Rv3198A; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
O Post-translational modification, protein turnover, chaperones
|
|---|---|
| eggNOG description | Glutaredoxin |
| Orthologous group | COG0695 |
| EC number |
EC 1.20.4.3
|
| KEGG orthology |
K18917
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Glutaredoxin | PF00462.31 | 1.2e-12 | 7–60 | Glutaredoxin |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: uvrD2 (ATP-dependent DNA helicase UvrD), medium confidence from genomic context alone (score 589 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3051c nrdE |
ribonucleoside-diphosphate reductase subunit alpha | 860 | 852 | database:614 |
Rv0570 nrdZ |
vitamin B12-dependent ribonucleoside-diphosphate reductase | 859 | 851 | database:614 |
Rv3198c uvrD2 |
ATP-dependent DNA helicase UvrD | 603 | 589 ctx | neighborhood:587 |
Rv0835 lpqQ |
lipoprotein LpqQ | 545 | 545 ctx | neighborhood:544 |
Rv0137c msrA |
peptide methionine sulfoxide reductase MsrA | 904 | 525 | experimental:484 textmining:807 |
Rv1170 mshB |
1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase | 609 | 480 ctx | cooccurence:477 |
Rv0486 mshA |
D-inositol 3-phosphate glycosyltransferase | 667 | 477 ctx | cooccurence:477 |
Rv1307 atpH |
ATP synthase subunit b/delta | 465 | 465 | coexpression:402 |
Rv3052c nrdI |
NrdI protein | 471 | 415 | |
Rv1082 mca |
mycothiol S-conjugate amidase | 787 | 408 ctx | cooccurence:407 textmining:656 |
Rv2466c hyp |
hypothetical protein | 400 | 326 | |
Rv2855 mtr |
mycothione reductase | 877 | 256 | textmining:842 |
Rv0794c |
oxidoreductase | 429 | 215 | |
Rv3221A rshA |
anti-sigma factor RshA | 408 | 199 | |
Rv2674 msrB |
peptide methionine sulfoxide reductase MsrB | 412 | 191 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): glutaredoxin protein
- Pfam (hmmscan --cut_ga): Glutaredoxin PF00462.31 (E=1e-12)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177941.1)
- Domains: Pfam-A via hmmscan --cut_ga — Glutaredoxin (PF00462.31)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0695 - Curated reference: UniProt P9WN17 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
22 functional partner(s); context anchor
uvrD2 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3198A| MITAALTIYTTSWCGYCLRLKTALTANRIAYDEVDIEHNRAAAEFVGSVNGGNRTVPTVKFADGSTLTNPSADEVKAKLVKIAG