Rv3768 Family assigned · medium auto-curated

H37Rv Rv3768 · MTBC0 mtbc0_003992 · 119 aa · 4238191–4238550 (+) · RefSeq NP_218285.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationnuclear transport factor 2 family protein
Revised (this work)Nuclear transport factor 2 family protein. Pfam: SnoaL_2 (PF12680.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P72035 TrEMBL · unreviewed · Evidence at protein level
UniProt nameSnoaL-like domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionSnoaL-like domain
Orthologous groupCOG4319

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SnoaL_2PF12680.14 9.6e-1318–109 SnoaL-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2561 (Rv2561, (MTCY9C4.07c), len: 97 aa. Conserved hypothetical protein, highly similar in part (and longer 33 aa) to upstream ORF AAK46951|RV2562), medium confidence from genomic context alone (score 552 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3899c hyp hypothetical protein 677 677 ctx cooccurence:676
Rv1060 hyp hypothetical protein 560 560 ctx cooccurence:560
Rv2561 Rv2561, (MTCY9C4.07c), len: 97 aa. Conserved hypothetical protein, highly similar in part (and longer 33 aa) to upstream ORF AAK46951|RV2562 552 552 ctx cooccurence:551
Rv3767c S-adenosylmethionine-dependent methyltransferase 549 549 ctx neighborhood:549
Rv3887c eccD2 ESX-2 secretion system protein EccD 549 549 ctx cooccurence:549
Rv3769 hyp hypothetical protein 518 519 ctx neighborhood:515
Rv1837c glcB malate synthase 528 498 coexpression:430
Rv0256c PPE2 PPE family protein PPE2 475 476 ctx cooccurence:471
Rv3912 rsmA anti-sigma-M factor RsmA 442 443 ctx cooccurence:440
Rv2557 hyp hypothetical protein 440 440 ctx cooccurence:436
Rv2487c PE_PGRS42 PE-PGRS family protein PE_PGRS42 439 439 ctx cooccurence:439
Rv1576c phage capsid protein 433 434 ctx cooccurence:432
Rv2423 hyp hypothetical protein 425 425 ctx cooccurence:417
Rv1057 hyp hypothetical protein 406 406
Rv2558 hyp hypothetical protein 405 405 ctx cooccurence:401

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: nuclear transport factor 2 family protein
  • Pfam (hmmscan --cut_ga): SnoaL_2 PF12680.14 (E=1e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218285.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SnoaL_2 (PF12680.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4319
  • Curated reference: UniProt P72035 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 20 functional partner(s); context anchor Rv2561
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003992|Rv3768|
MGSTPPRTPQEVFAHHGQALAAGDLDEIVADYADDSFVITPAGIARGKEGIRQLFVKLLDDIPNALWDLKTQIFEGDILFLEWTANSAVSRVDDGVDTFVFRDGTIWAHTVRYTPHPKT